CAZyme Information: MGYG000001357_01357

Basic Information

• Species: Helicobacter pylori_C
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_C
• CAZyme ID: MGYG000001357_01357
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		39556.5	9.9462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001357	1566655	Isolate	not provided	not provided

• Gene Location: Start: 1395111; End: 1396160 Strand: +

Full Sequence      

MSVNAPKRMRILLRLPNWLGDGVMASSLFYTLKHHYPNAHFILVGPQMTCELFKKDEKIE
AVFIDDTKKSFFRLLATHKLAQKIGRCDIAITLNNHFYSAFLLYATKTPVRIGFAQFFRS
LFLSHAIMAAPKDYHQVEKYCFLFSQFLKKELDKKSVLPLKLAFNLPTRTPNTPKKIGFN
PSASYGSAKRWPASYYAEVSAVLLEKGHEIYFFGAKEDAIVSEEILKLIKGLLKNPLLSN
NAYNLCAKTSIEELIERIAILDLFITNDSGPMHVAASAQTPLIALFGPTDEKETRPYKAQ
KTIVLNHHLSCSPCKKRVCPLKNEKNHLCMRSITPLEVLKAAHTLLEKP

Enzyme Prediction     

No EC number prediction in MGYG000001357_01357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	324	4.8e-55	0.9733333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.32e-89	8	349	1	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.12e-83	78	323	2	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	9.02e-80	10	343	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	7.71e-63	10	347	1	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	1.82e-33	9	346	1	343	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU41461.1	1.83e-257	1	349	1	349
BAW64576.1	4.30e-256	1	349	1	349
ANH43516.1	2.39e-253	1	349	1	349
BAW61418.1	6.84e-253	1	349	1	349
AEE70807.1	1.38e-252	1	349	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	1.49e-24	10	304	2	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	3.22e-19	10	346	10	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	2.58e-36	9	304	1	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	3.85e-29	9	348	1	345	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	9.62e-27	9	304	1	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
Q9R9D5	1.31e-07	20	297	5	287	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
Q57336	5.70e-06	1	304	3	299	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001357_01357.