CAZyme Information: MGYG000001358_00980

Basic Information

• Species: Campylobacter_D upsaliensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_D; Campylobacter_D upsaliensis
• CAZyme ID: MGYG000001358_00980
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215		25146.95	6.9628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001358	1621701	Isolate	not provided	not provided

• Gene Location: Start: 959151; End: 959798 Strand: +

Full Sequence      

MKIFIINLLRSTHRKESMKEQISKLFSENPSLKDRLEFIFFEAVDGGGGEEFAKFHPAWA
KYLFGRELSLGEKGCFASHYKLWQKCLELNEGIFVIEDDVEFTQAFNANNLEKILKSPYE
YVRIYHIKEAKFYDLELNFKITFSNVAGTQGYYLKPSAARKFIKKCQFLIKPVDDSMDYS
EVLNIVFTPLFLKELPLQSDIATREREREQLQAHA

Enzyme Prediction     

No EC number prediction in MGYG000001358_00980.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	177	3.4e-42	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01755	Glyco_transf_25	6.86e-37	2	177	3	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	2.20e-36	2	177	1	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
COG3306	COG3306	4.49e-28	1	179	3	189	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG85088.1	4.63e-116	1	209	1	210
ARE80240.1	6.10e-114	1	215	1	216
CDG57196.1	1.49e-70	1	201	1	209
QLD92844.1	1.72e-69	1	214	1	223
QOP70424.1	2.43e-69	1	214	1	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q29NU5	8.39e-10	3	187	344	528	Glycosyltransferase 25 family member OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA16561 PE=3 SV=2
Q17FB8	2.05e-09	3	106	325	426	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1
P71398	2.53e-09	1	197	2	220	Lsg locus putative protein 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1697 PE=3 SV=1
Q5UQC3	1.00e-08	2	106	4	115	Procollagen lysyl hydroxylase and glycosyltransferase OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L230 PE=1 SV=1
Q7Q021	1.67e-08	3	106	321	422	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001358_00980.