CAZyme Information: MGYG000001359_00896

Basic Information

• Species: Bilophila wadsworthia
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila wadsworthia
• CAZyme ID: MGYG000001359_00896
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001359_1|CGC5	36584.46	9.8871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001359	4391094	Isolate	not provided	not provided

• Gene Location: Start: 963713; End: 964687 Strand: -

Full Sequence      

MIRLSALGDVALTTGVLEYWHRTRGWTFTVITREAFAPVLERHPAVCSIVGLAKEDLRFP
RQLGVFRDLAEAHAGQGLLDLHGTLRTRLLSLLWKGPVKRYRKLGLERRLFLRSKGRLFR
NELRLWNVPQRYALAVEATPPPRAALLPHIWLSDEEIRQGQRLLEQLPDKAGTPPIALHP
YATHPDKAWKEAYWRQLMELFESRGIPWIVIGRGSCMEGIPASRNFTNRTSLRETCALLK
SSSLLITGDSGPMHLAGAVGTPVLALFGPTTEEWGFFPAGPKDRVLESQLDCRPCTLHGK
KHCDRNHACMQSITPEQVMRALDE

Enzyme Prediction     

No EC number prediction in MGYG000001359_00896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	310	9.6e-47	0.9244444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.56e-43	2	324	5	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.15e-34	1	324	6	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	4.78e-19	153	295	85	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	4.21e-18	130	324	132	331	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
TIGR02201	heptsyl_trn_III	1.48e-09	161	270	171	289	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS96432.1	2.41e-133	1	322	10	329
ADP86511.1	2.58e-133	1	322	12	331
ABM28232.1	6.88e-133	1	322	10	329
QGY41725.1	6.14e-116	2	318	13	327
AGC49436.1	4.73e-113	1	322	20	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	1.85e-09	1	270	5	282	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.85e-09	1	270	5	282	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.91e-09	1	270	5	282	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	1.20e-06	4	323	16	342	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	7.29e-09	1	270	5	282	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P45042	2.64e-08	130	324	131	342	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P26469	3.32e-06	1	270	5	282	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001359_00896.