CAZyme Information: MGYG000001359_01434

Basic Information

• Species: Bilophila wadsworthia
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila wadsworthia
• CAZyme ID: MGYG000001359_01434
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000001359_1|CGC9	47258.2	9.5134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001359	4391094	Isolate	not provided	not provided

• Gene Location: Start: 1549664; End: 1550986 Strand: -

Full Sequence      

MGEPNIGSGKIVHEQHPLLKVPQKRGAGTAALAAAVLALGLLAGCAAPLPAPSAPVRDVA
GDLVPENDEQAAVLAGKLDRAGQRLHSWKELAPALRASRAHIAGREPGQVAVAHGDVAVT
WGDVAKTLDCLEALLPRLDAEPGLLAERFRWVKLKDGAAFSGYYEPVVKASRTRKPGYTA
PLYRVPPDLRELNLGSFKSELIGQRVVYRMEKGKPVPYYTRAEIDGLDGRPGVLRGKGLE
LAWLSDPVDAFFLQVQGSGRLRFEDGKEMPVRFAGSNGKPYLSIGRYLADQGEIPTGQVS
MQSIRQWLREHPELRDDLLRRNQRYIFFRKGPETSSGSITSGPVGSMGSPLSSMVSLAVD
RTTFPLGSVLAFNVNIPDPSSPVEEGPVSTTPLFGIGLAQDTGEAIKGRRVDLFCGKGAR
AAYIAGHLNGPGEIWMLLAK

Enzyme Prediction     

No EC number prediction in MGYG000001359_01434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	168	329	1.1e-57	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03562	MltA	1.42e-87	145	329	50	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	2.01e-83	168	329	1	157	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
COG2821	MltA	7.94e-80	160	440	125	366	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
smart00925	MltA	1.28e-72	167	329	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	3.55e-55	160	437	118	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM29113.1	4.54e-115	37	440	3	401
ADP85981.1	7.64e-114	52	440	62	424
AAS95367.1	7.64e-114	52	440	62	424
CAJ54777.1	3.47e-101	66	440	48	403
AGC50144.1	3.47e-101	66	440	48	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESJ_A	1.52e-54	161	440	103	360	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
6QK4_B	5.28e-47	161	437	104	344	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
2G5D_A	3.96e-44	161	438	119	412	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	1.47e-41	161	438	119	412	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
2PNW_A	6.30e-39	161	440	99	364	Crystalstructure of membrane-bound lytic murein transglycosylase from Agrobacterium tumefaciens [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	4.86e-29	160	437	118	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	4.86e-29	160	437	118	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
P57531	2.73e-27	161	440	119	359	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1
Q9KPQ4	5.91e-27	136	437	89	349	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
Q8K9A7	4.13e-24	161	437	127	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003202	0.432842	0.563769	0.000082	0.000127	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001359_01434.