CAZyme Information: MGYG000001359_01899

Basic Information

• Species: Bilophila wadsworthia
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila wadsworthia
• CAZyme ID: MGYG000001359_01899
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001359_1|CGC14	41364.77	9.691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001359	4391094	Isolate	not provided	not provided

• Gene Location: Start: 2100675; End: 2101790 Strand: -

Full Sequence      

MKTIWINAGELSGDMQAAALLTALREREPELAAIGMGGPNLARAGQKNLFRVESLSVMGI
MEVLTALPRALHMLSQIKKEMARLRPDAVVLVDAPEFNFRVAKIAHGLGIPVYYFIPPKI
WAWRTGRVRFLQRYVKRLFCILPFEPAFYAKHGVQVDYIGNPLVDMVNWPELEKIEPIKG
RIGLMPGSRRKEVEALLPEFGKAARILLQQGRDVTFHCLRAPNMPEEKLRALWPSDVPVA
FDAPEDRYTAMRRCGCMLAASGTATLETALAGVPTVVSYRVAPFSALVGRLLIKVKWVSL
TNLIMQKELFPELLQERATGEMMASQLAAWLDMPPQIEAVRAELAELRRRCGEPGSAARA
AEKLLEALKES

Enzyme Prediction     

No EC number prediction in MGYG000001359_01899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	350	1.4e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.22e-115	1	369	1	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.25e-113	1	370	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.87e-89	4	328	1	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.61e-74	3	366	7	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.28e-51	1	321	1	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM28724.1	1.57e-159	3	368	4	369
AAS95839.1	3.16e-159	3	368	4	369
ADP86417.1	3.16e-159	3	368	4	369
CAJ55109.1	1.06e-146	1	361	1	361
AGC50489.1	1.06e-146	1	361	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.43e-49	3	360	8	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.81e-49	3	360	8	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.86e-77	4	368	7	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.58e-74	2	371	4	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	8.46e-70	4	362	12	380	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q1INL4	2.12e-69	1	348	1	354	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q39T49	4.46e-69	2	368	7	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001359_01899.