CAZyme Information: MGYG000001359_02678

Basic Information

• Species: Bilophila wadsworthia
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila wadsworthia
• CAZyme ID: MGYG000001359_02678
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		66009.49	10.3863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001359	4391094	Isolate	not provided	not provided

• Gene Location: Start: 3028996; End: 3030813 Strand: +

Full Sequence      

MRLNGVLPSCVAFRPSGVLGVLLLCVLVALTGCSSKNITSKGPFVLQEPSKGYPSVPSSS
GQKTGTVYLPSDDGRPLTKAEQEAFLSEGEIDRNLPQEELGDVLLHFKYLVHKDRYTVEK
NLERAQLYMPFIYETLRSRGLPRELAYVAFIESGYNPMATSSSGAAGMWQFISSTGKHYG
MEQDWWMDERRDPYQSTRAAADYLDKLYKMFNDWHLAVTAYNAGEGKIQRGLAATGAKTF
FELRRKNEQIYSVRDRLSDENKQYLPKFLAVCKIVRNLDKLGFSCATFASSSQIAEVRAK
PGTDLMLFSKSIGMSWEEFSAHNPAYQRYVSHPSRSTKIYVPRAMAGKAQALLFKLPPAN
SGKSYAGLRDYKISRGDTMASISRKTGVPVAELRRINQVSEPLRAGRVLKIPGNNRTGVD
PRALASVRGVPSAKGTSVASAGRQVTPSRPVSASAPVREKVVSTASAASHEVKQGDTMYS
IAKRYGVTQEAILAANGMKNHNISLGQQLRIPGKGAAVASQSAKKAPVASSVRPVVASVS
SVPVSRPVAEAKATNKIVQYTVQNGDTLWAIARKFNVSPVELLSLNNMSRNTALRPGDTV
RVAVN

Enzyme Prediction     

No EC number prediction in MGYG000001359_02678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	128	273	9.8e-27	0.8888888888888888
CBM50	470	512	8.4e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	5.46e-63	31	509	14	444	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	6.73e-62	136	271	1	127	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	7.65e-33	131	243	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.71e-18	152	233	11	90	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01476	LysM	1.15e-15	470	512	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC49455.1	2.48e-162	30	605	36	555
CAJ54111.1	2.48e-162	30	605	36	555
ADP85240.1	8.56e-152	28	602	28	584
ABM29931.1	8.56e-152	28	602	28	584
AAS94525.1	8.56e-152	28	602	28	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	5.29e-06	468	514	3	49	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	6.63e-36	28	511	11	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	6.63e-36	28	511	11	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	7.10e-18	124	233	21	131	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
Q5HRU2	9.87e-10	371	602	29	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	9.87e-10	371	602	29	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000027	0.002390	0.997622	0.000007	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001359_02678.