CAZyme Information: MGYG000001359_02959

Basic Information

• Species: Bilophila wadsworthia
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila wadsworthia
• CAZyme ID: MGYG000001359_02959
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	MGYG000001359_2|CGC2	28478.68	11.4369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001359	4391094	Isolate	not provided	not provided

• Gene Location: Start: 166258; End: 167022 Strand: +

Full Sequence      

MWARIRAAIASRWPKVKKCLRILSRHLVRPFWEGFWLGVKLMATGFTVGVGFWLALGFLC
GLAHAAEVTIPRAAQQHRTTLTRAAHATWGMNAPVSVFAAQVHTESWWRNNTVSHVGAQG
LAQFMPSTARWLPSVAPETGKPEPFNPGWSLRALCTYDKWLWERNSGANDYERMAFTLSA
YNGGQGWVNRDKKLARQRGLDAARWFGVVATVNAGRSAAAWKENRNYPRLILEERQHAYI
RAGWGPGIEGGARP

Enzyme Prediction     

No EC number prediction in MGYG000001359_02959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	95	236	4.6e-17	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.96e-23	99	212	16	123	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	6.20e-18	92	186	2	96	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.82e-13	98	236	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.47e-13	99	233	23	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.11e-11	87	199	4	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV72330.1	3.02e-109	63	253	10	200
SFV71937.1	1.71e-101	95	253	1	159
AAS95608.1	8.34e-78	54	251	19	218
ADP86211.1	8.34e-78	54	251	19	218
ADU63417.1	1.74e-77	62	248	15	199

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.937726	0.058659	0.002111	0.000640	0.000232	0.000612

TMHMM  Annotations     

start	end
34	56