CAZyme Information: MGYG000001360_00449

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_00449
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000001360_1|CGC6	34109.8	9.8609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 504174; End: 505034 Strand: -

Full Sequence      

MGTRRTSNKKTTQTLHTKSKRRCRRSRRSFFRRYPKWAVILGAVGMVALYVWCFYYFFVS
PTGFRWRALYGDAKYPDGYENHGIDISHYQADIDWERLSNAMIEGCPIRFIIIKSTEGAG
KLDKNFYKNYQSAGDYGFIRGAYHFWSNKSSARDQAHFFLNKVHLNDGDLPPVLDIEHKP
KDKSVEEFQRDVLTWLHIVEDKYHVKPIIYTYYKFKQNYLSAPVFNDYPYWIAHYYVDKV
EYKGPWKFWQHTDAGRLPGIKGYVDFNIYNGSYYDLKQMTIGRNKW

Enzyme Prediction     

No EC number prediction in MGYG000001360_00449.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	84	260	2e-50	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	5.11e-71	82	271	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	2.11e-58	79	271	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	9.14e-49	82	269	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	3.61e-42	84	260	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	3.66e-41	76	272	58	256	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15533.1	2.38e-192	1	286	2	287
BCS86629.1	2.28e-177	13	286	14	290
QNT67813.1	8.24e-160	22	284	13	275
ALO48669.1	1.08e-158	29	285	28	284
AGB29161.1	9.07e-149	29	282	35	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	4.15e-23	83	272	7	205	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZMV_A	4.57e-12	83	282	4	206	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
6ZM8_A	5.69e-11	83	282	4	207	ChainA, muramidase [Sodiomyces alcalophilus]
5JIP_A	6.19e-08	71	267	4	220	Crystalstructure of the Clostridium perfringens spore cortex lytic enzyme SleM [Clostridium perfringens],5JIP_B Crystal structure of the Clostridium perfringens spore cortex lytic enzyme SleM [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	1.14e-50	41	282	18	267	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	1.14e-50	41	282	18	267	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	6.34e-50	41	282	18	267	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	9.82e-22	83	272	84	282	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
D4ANU4	5.69e-12	83	282	32	234	N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05911 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000027	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59