CAZyme Information: MGYG000001360_00904

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_00904
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	MGYG000001360_1|CGC12	45645.35	9.5804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 1046570; End: 1047793 Strand: +

Full Sequence      

MKKIVLLLLSCWLFMGVAQAKVLTGIEVLKHQNFKILAGKRVGLVTNPTGVDNELRSTID
VLHAAKNVKLVALFGPEHGVRGNAHAGDKVGNTKDKRTGLPIYSLYGTQREPTDEMLKDI
DILVYDIQDIGCRSFTYISTLGNIMKAAAKHNIKVVVLDRPNPLGGLKIEGNLTEEDCKS
FVSAFKIPYVYGLTVGELAMLLNGEHMLGKPCMLEVVKMKGWKRKMDYSATKLKWVPASP
HIPQAEAAPFYAMTGIVGELDSLNIGVGYTLPFQLLGASWIDADKFADDMNALQLPGLLF
RPIHYVPFYGKQKGQALQGVQIYFTDYAKARLCDVQFYALQVLNQRYPSHDILGESGQRT
TMFDKVCGSKVIRTRFLQRHNWQDVVGYWDKDIMPFKALSKKYYLYK

Enzyme Prediction     

No EC number prediction in MGYG000001360_00904.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	42	406	1.8e-127	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	0.0	43	406	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	1.51e-146	1	406	1	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ31129.1	4.31e-185	21	407	37	424
QCQ53402.1	4.31e-185	21	407	37	424
QRM69459.1	4.31e-185	21	407	37	424
AUI48824.1	1.75e-184	21	407	37	424
QCQ35542.1	1.75e-184	21	407	37	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	8.01e-176	19	407	10	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	1.11e-47	19	407	3	369	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.13e-105	19	406	34	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999142	0.000162	0.000153	0.000148	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_00904.