CAZyme Information: MGYG000001360_01587

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_01587
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000001360_1|CGC20	38853.56	9.9356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 1851880; End: 1852920 Strand: -

Full Sequence      

MKHLLLIRFSALGDVAMLVPVVASLMKQYPDIHVTVLSKPFARSLFEGLSPNVSFMSADL
KKDYQGLSGLNALYRRLAAKNFTAVADMHDVLRTKYLRLRFHLCGFHVAHIDKHRKGKQL
LCSEKNKVKVQQPTSFENYAAVLAKLGYPVSLEFHSIFGEKGGNLRQLMPLIGEKKKFQR
WIGIAPFAAHKGKIYPLEKMEQTIEQLIKAYPSCRIFFFGGGGKERETLDSWAKRYANCT
NASAVLGGMRNELILMSHLDVMISMDSGNMHLASLVGTKVVSIWGATHPYAGFMGWNQSE
ENAVQLDMACRPCSVYGNKPCLRGDYACMNDIRPEMIVAKIKQLFN

Enzyme Prediction     

No EC number prediction in MGYG000001360_01587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	321	3.9e-34	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.59e-53	3	343	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.20e-38	1	344	1	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.92e-16	72	319	3	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	1.14e-06	254	344	247	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	6.99e-06	2	287	6	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14583.1	2.27e-213	1	346	1	346
ALO49713.1	5.63e-164	2	344	4	346
BCS85074.1	1.55e-163	2	344	4	346
QUB77359.1	5.15e-162	3	343	5	346
QUB83791.1	1.65e-160	3	342	5	345

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	9.97e-07	2	344	9	344	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999375	0.000628	0.000011	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_01587.