CAZyme Information: MGYG000001360_01845

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_01845
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000001360_1|CGC22	45629.96	8.6305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 2173136; End: 2174329 Strand: -

Full Sequence      

MKIRKLLLSLGVFLMTPAFCHAENNDISNVINNDINFSTRQYSLMLQQIGREGKVRIPKT
IDKLGRMVYIPIDDWCSGFFPGSLCYLYQLTNDKSWLLQSKRFTEALDSIQYLTWHHDVG
FMIGSSYLNIYRLNPNKAYKKAIIQTAKSLCTRFRKKAGVIQSWNVDRGWQSKRGWTCPV
IIDNMMNLELLFEATRLSGDSTYWKVAVSHANKTLENQFRKDGSCYHVVDYDPNNGAVLH
RQTAQGYADNSAWARGQAWAVYGYTVCYRYTHDRKYLDQAVKTLNFVMQNPNLPDDLIPY
WDFDAPNIPNEPRDASSAACIASALYEMNNYLPDNGYTSLADRIIRSLSSPEYRAPLGKN
GCFLLMHSVGSIPHNNEIDVPLNYADYYFLEALTRRK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	72	395	3.7e-123	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.21e-09	74	396	28	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14502.1	1.11e-264	1	397	1	397
AGB28567.1	4.96e-196	4	395	2	391
QDO68073.1	1.65e-190	4	397	2	395
QUU01323.1	2.34e-190	4	397	2	395
QUT61419.1	6.69e-190	4	397	2	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.83e-104	58	395	56	387	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	4.13e-48	54	395	25	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.22e-48	54	395	26	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.61e-47	54	395	26	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	2.25e-47	54	395	26	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.71e-101	53	397	54	395	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	2.31e-47	54	395	26	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.27e-44	58	395	52	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	1.69e-43	56	395	23	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	7.34e-43	54	395	49	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000725	0.863190	0.135290	0.000318	0.000242	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_01845.