CAZyme Information: MGYG000001360_02247

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_02247
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001360_1|CGC36	41649.09	7.5683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 2689117; End: 2690220 Strand: -

Full Sequence      

MKKYFIFGCLALLFTATSCSDWTEVENKNIDKLLANADSAQSRAYKDYLINLRAYKNTDH
QVTFGWFGGWNGESPASRCLYNLPDSTDFVSLWDGFSNLTAAQQADLKRAKEEKGIRALA
CALLFDIGKGVTPAQPESSKKAGESWETYNKKYWGWVDGDEQKINASIVKYANAICDTIY
KYNLDGFDLDAEPNIPQPFRTNKEMWKNDRMNLFIRTMGKRIGPKAETEEGRKKLLVVDG
EPYWFSADMALYFNYYILQAYDCSSYADLDNRFSQLVLQFSSKQTEEEIAKKLIVTENFE
AHSGTGGVTFTTRDGQSVPSYLGMATWQPLKGRKGGIGSYHMEKDYAANPVYKYLRKGIQ
LMNPAVK

Enzyme Prediction     

No EC number prediction in MGYG000001360_02247.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	4.64e-63	45	359	21	316	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	7.62e-49	61	356	1	255	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
cd00598	GH18_chitinase-like	0.007	155	262	73	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd02878	GH18_zymocin_alpha	0.007	166	275	90	199	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14237.1	5.03e-239	1	367	1	367
QUB40154.1	1.38e-236	1	367	1	367
QUB83280.1	4.60e-235	1	367	1	367
ADV43846.1	1.65e-154	5	365	10	379
QUB47283.1	2.43e-116	13	367	15	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	4.87e-53	1	363	3	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	1.15e-10	55	364	24	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	1.26e-11	49	364	49	335	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000301	0.999731	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_02247.