CAZyme Information: MGYG000001360_02511

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_02511
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	MGYG000001360_1|CGC41	57673.43	8.1216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 3027759; End: 3029306 Strand: -

Full Sequence      

MKLKTLLATVCLLGSAIYPSTVSAQFKWPYKIMNGKAVTGVPTREAGQQSALNLVTPKLK
VVRVAFVGLGMRGPGAVERWTHIPGIQIMALCDYEQNRAERCQDFLRKASMPAATIYSGE
DGYKALCKRKDIDLVYIAPDWKHHFLVAREALLNGKHVAIEVPAAMNMAEIWELINLSEK
KRLHCMMLENCCYDFFELNALNMAQKGVFGEILYAQGAYRHDLTPFWNAYWKQGPQDKLG
WRLDYNMKHRGDVYATHGLGPIAQVLDIHRGDRMKTLIAMDTKSVNGKMHVEQMSGEKCN
DFKNGDQTTTLISTENGKVIEIIHNVMTPQPYNRMYQLTGTKGFANKYPIEGFALSSKEL
SKAGVTPSADDLSGHSYLPQKDADALVQKYESPIVAKYEKEAKEVGGHGGMDFIMDSRLV
YCLQNGLPLDIDVYDLAEWCCLAELGSISMNNGNIPVEVPDFTRGEWNKIHGFHHAYASA
ADEKKAADEAAAFTLKLKEQGKKYWEKVDKAAKKK

Enzyme Prediction     

No EC number prediction in MGYG000001360_02511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	58	469	1.4e-152	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.48e-22	60	353	2	265	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	8.31e-12	62	187	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	4.90e-05	108	214	44	147	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15064.1	0.0	1	515	45	559
QUB39974.1	0.0	1	515	1	515
AUI55632.1	0.0	1	515	1	515
QUB82610.1	0.0	1	515	1	515
QUB79140.1	0.0	1	515	1	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.19e-77	36	467	17	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.30e-70	60	467	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E9M_A	1.10e-07	98	216	39	152	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3E82_A	1.67e-07	67	212	8	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3EVN_A	5.92e-06	100	213	41	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	1.89e-262	9	514	16	520	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	2.66e-254	2	505	3	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	3.05e-208	1	499	1	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	4.15e-203	12	478	9	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	1.36e-202	7	478	12	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000330	0.998906	0.000178	0.000222	0.000188	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_02511.