CAZyme Information: MGYG000001360_02609

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_02609
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000001360_1|CGC42	62329.41	7.2703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 3144663; End: 3146318 Strand: -

Full Sequence      

MKMNKIITIALMVFSVMGIQTAEAQSSSPSTKWHWDKGTIVVETPERPAGQEPVLGLTAK
PIKKVRVAFVGLGMRGPSAVIRFCQIPGVEIVGLCDYEKERAEAQQTHLRKAGLAPATIY
FGEKGYEELCKRSDVDLIYIATDWNHHFPIAKCAMENNKHVAVEVPSAMNLEQCWDLINL
SEKTRKHCFILENCCYDDFEMKSLLMAKDGVFGEIIRAEGAYIHELSEFWTHYWKDPNDN
DKDNLHWRMKYNLENRGDIYATHGLGPVAQCMNIHRGDRFTTLVAMDTESFAGKEWVKNH
TGKEPKMFLNGDHTTTLMRTAKGKVVEIQHNVMTPQPYNRLFKLTGTKGYATKYPTEEFA
IGGQALEGTDAPKMDDINAHGFLNAEQKKALMEKYRHPILEKYAEKGRHLGHGGMDYVMD
SRLVYCLQHGLPLDMDVYDMAEWCALAELGALSMNNNCAAVTFPDFTRGHWNDVKGYTHA
YATPEQEKAQETYSAAYTDAQKEATAKLKLWELYDAAKSAKGKDKFAAEKKYKKAADGLN
IQIEKILKKKL

Enzyme Prediction     

No EC number prediction in MGYG000001360_02609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	61	472	1.6e-151	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.24e-20	63	359	2	265	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.73e-12	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	6.90e-09	134	215	64	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38645.1	5.76e-298	1	550	1	547
QQY38775.1	5.76e-298	1	550	1	547
QFQ13386.1	6.25e-253	1	519	1	520
QCQ31109.1	1.55e-250	4	509	6	504
ALK83890.1	4.20e-246	20	525	23	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	6.33e-84	47	471	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.59e-64	63	475	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	5.52e-06	65	222	8	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KYY1	1.15e-298	1	550	1	547	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6L1Z2	3.40e-246	20	525	23	520	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	3.72e-242	1	507	1	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
Q89ZX8	7.93e-183	3	482	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	1.89e-180	40	482	29	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000437	0.998685	0.000235	0.000239	0.000199	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_02609.