CAZyme Information: MGYG000001362_01235

Basic Information

• Species: Streptococcus anginosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus anginosus
• CAZyme ID: MGYG000001362_01235
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		31373.47	10.1957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001362	1815545	Isolate	not provided	not provided

• Gene Location: Start: 94791; End: 95615 Strand: -

Full Sequence      

MKRTNLRYVWLVAILLAIITIFTYVRFNSTGHLKNQIYQQWSKNYVVQQKDKAYVKTTND
KKKDVVLSESQGYGMVAAVEAAKQGYASQKDFERLYNYYLAHRMKNTQLMSWRQTVKNGV
VTAETNNATDGDLYIAYALIRAAKLWPQKADAYHTQARAILKDILTYNYNSTTGVLTVGN
WATSDSKYYRLMRTSDVLPAQFQAFYKLTGNAQWLKIKSNMLSKLELMSAKSKTGLLPDF
LWVEADTVRAAEKKLLLLSMTVIIITMLVACHII

Enzyme Prediction     

No EC number prediction in MGYG000001362_01235.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	36	247	8.7e-51	0.621875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	8.38e-21	35	246	5	206	Glycosyl hydrolases family 8.
COG3405	BcsZ	9.22e-14	38	246	29	229	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	8.86e-08	68	247	54	228	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VED98896.1	4.59e-169	1	254	1	254
AZQ42284.1	1.02e-165	1	254	1	254
ALL03661.1	1.96e-163	1	254	1	254
AGU82194.1	1.96e-163	1	254	1	254
BAN61023.1	2.28e-162	1	254	1	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	6.46e-24	67	256	93	284	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.60e-14	60	240	65	245	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.66e-14	60	240	71	251	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	5.63e-11	68	247	33	206	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
5CZL_A	3.26e-07	68	246	57	229	ChainA, Glucanase [Raoultella ornithinolytica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	6.69e-23	67	256	93	284	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.81e-13	68	240	129	301	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P18336	2.42e-07	68	246	52	224	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P27032	4.05e-07	63	246	47	224	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P37696	1.81e-06	68	247	56	229	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.989894	0.003473	0.002291	0.000026	0.000014	0.004330

TMHMM  Annotations     

start	end
6	28
255	273