CAZyme Information: MGYG000001363_00310

Basic Information

• Species: Streptococcus equinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus equinus
• CAZyme ID: MGYG000001363_00310
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000001363_1|CGC2	40511.25	7.0345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001363	1718648	Isolate	not provided	not provided

• Gene Location: Start: 319900; End: 320964 Strand: +

Full Sequence      

MISKNEWYQVVENYGNQMHAGSKATNDVSDILSGMGFNNLYIENSPRQKNPFKKVLRQSD
YARQWKKLPRDIKDGSILILQHPFHIKQLGRKKSLSKLKKEKHVKIISIVHDVEELRGLF
KLDYYNVEFRDMVSLADAIIVHNSSMMNWFIEKGVNKDKLITLEIFDYLNSKVLKLNHDL
SKHVVIAGNLSKSKSPYIYKLPELSNLEFKLFGINYDETEIAENVSYEGAFPADEVPMEL
NSGFGLVWDGDNLETCSGNTGNYLRYNNPHKLSLYLSSGLPVIVWSESAESEFVEKNKVG
FSVSSLEEISTIFEALSEEQLIEFKKNAIEIGNKLKQGHYLSTAVKEAINRINF

Enzyme Prediction     

No EC number prediction in MGYG000001363_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	15	349	2.9e-106	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.16e-98	8	352	4	333	sugar transferase.
cd03794	GT4_WbuB-like	3.44e-12	103	303	123	344	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALT80985.1	2.81e-130	8	352	6	350
AYF95086.1	2.23e-123	8	349	4	345
AXQ78538.1	3.75e-123	8	351	4	347
AND80439.1	7.42e-117	18	349	1	332
QTE73678.1	3.61e-107	8	352	4	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	5.45e-17	24	350	22	331	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	2.27e-47	20	350	14	325	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	6.97e-23	24	349	20	330	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	2.41e-22	24	352	20	332	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
F8KEJ1	4.33e-18	103	354	97	339	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B3XPQ7	7.52e-18	103	349	92	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001363_00310.