CAZyme Information: MGYG000001363_00581

Basic Information

• Species: Streptococcus equinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus equinus
• CAZyme ID: MGYG000001363_00581
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		35068.33	4.7071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001363	1718648	Isolate	not provided	not provided

• Gene Location: Start: 588565; End: 589506 Strand: +

Full Sequence      

MKKRYKHEKNSKKPLAIINIILLLACIIASVFLFFVLKDNHLILSNEKTEHVVQKKAKQS
STTSSNSSSQADQSIEKTEEVNWVQQDSDVSLPILMYHAIHEMAPEEESNANLIVDPATF
ESHIQRLSEEGYYFLTPEEAYKVLSGNVLPNGNSKIIWLTFDDSLWDFYTNAYPILKKYQ
AKGTNNVITSTVGDNGNLTLDQMLEMKEQGMSFQSHTSTHPDLSVSDDDTQKSEMEDAKT
YLDNNLSQDTMAIAYPAGRYSDTTLQLASNLNYKIGVTTNEGIANKEDGLLSLNRVRILP
ETTADSLIASISQ

Enzyme Prediction     

No EC number prediction in MGYG000001363_00581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	153	278	2e-24	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.09e-46	157	298	2	154	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
pfam01522	Polysacc_deac_1	1.59e-31	151	274	3	122	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
COG0726	CDA1	1.35e-30	92	277	1	184	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10969	CE4_Ecf1_like_5s	2.01e-30	117	308	1	211	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10970	CE4_DAC_u1_6s	7.08e-30	159	284	5	130	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	5.04e-44	83	300	56	264
BAJ62458.1	1.21e-27	89	312	92	308
AEG60900.1	1.81e-24	94	307	37	243
AEI34796.1	3.72e-23	81	307	20	238
AAK76800.1	3.72e-23	81	307	20	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	1.01e-94	87	308	4	225	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
6GO1_A	1.32e-16	92	282	100	285	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	2.09e-47	83	300	56	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6GDD6	1.04e-13	112	281	74	254	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q6G606	1.42e-13	112	281	74	254	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	1.42e-13	112	281	74	254	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	1.42e-13	112	281	74	254	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000007	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
15	37