CAZyme Information: MGYG000001363_00636

Basic Information

• Species: Streptococcus equinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus equinus
• CAZyme ID: MGYG000001363_00636
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217	MGYG000001363_1|CGC8	24112.65	4.9714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001363	1718648	Isolate	not provided	not provided

• Gene Location: Start: 642089; End: 642742 Strand: -

Full Sequence      

MAKVRKIKGRRKVRRNRTSKKLSKSVLYGMVFLAFLSCSTLMFYAISSQDGAYSASADTS
QSSQDTTTISFIQEIGETARQIAAQNDLYASVMIAQAILESNSGQSALSQPPYYNYFGIK
GDYNGQSTTMQTWEDDGSGDAYTIDAQFRSYGSQDESLQDYAQFLQKDIYAGVRKSNTTT
YQDATAALTGTYATDTSYGSKLNQIILEYDLTIYDSW

Enzyme Prediction     

No EC number prediction in MGYG000001363_00636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	76	211	7.5e-31	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	8.34e-61	39	215	293	472	amidase domain-containing protein.
COG1705	FlgJ	1.78e-58	20	215	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	7.18e-57	67	216	149	304	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	6.33e-30	68	212	8	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	5.22e-22	76	161	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE22761.1	3.97e-145	1	217	1	217
VTS87571.1	1.09e-142	1	217	1	217
VED92015.1	1.09e-142	1	217	1	217
QMS95673.1	3.36e-142	1	217	3	219
QGX45036.1	9.22e-140	1	217	3	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.85e-38	71	215	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.42e-34	71	215	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	9.86e-36	71	216	183	334	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	2.62e-34	71	215	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	9.85e-34	71	215	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P39046	1.22e-33	68	216	62	215	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	1.90e-33	71	215	323	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960975	0.012823	0.022385	0.000143	0.000070	0.003609

TMHMM  Annotations     

start	end
25	47