CAZyme Information: MGYG000001363_01582

Basic Information

• Species: Streptococcus equinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus equinus
• CAZyme ID: MGYG000001363_01582
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196	MGYG000001363_4|CGC1	22359.56	6.7314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001363	1718648	Isolate	not provided	not provided

• Gene Location: Start: 45901; End: 46491 Strand: -

Full Sequence      

MKSRFSLVQFLIFLAVLVFGIFSPLYAHRAIPNADKVEKVSYTQKEFFDTIAPSVQEVAS
AYGVKSSIVMAQAALESNYGRYLLASKYHNLFAVAAQPGDKIITLKYRHYFVNEWQTEIG
QFAVYKSWDDAIYDYFALLKEEKISNSKGAYELMVSDKGYKKLAQALQDMSFSTDPDYAD
KLVKIIEENNLTSYDK

Enzyme Prediction     

No EC number prediction in MGYG000001363_01582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	191	1.1e-27	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.67e-44	1	196	1	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	8.59e-22	38	195	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	9.63e-20	30	196	305	473	amidase domain-containing protein.
PRK05684	flgJ	2.21e-19	44	186	152	294	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.73e-17	43	195	159	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE21178.1	4.56e-136	1	196	1	196
VTS81640.1	5.12e-133	1	196	1	196
VED90675.1	5.12e-133	1	196	1	196
QMS96675.1	5.12e-133	1	196	1	196
QGX44073.1	2.96e-132	1	196	1	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	3.61e-13	47	191	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.29e-13	47	191	5	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3FI7_A	1.05e-12	44	195	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3K3T_A	3.12e-12	47	191	5	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	9.61e-10	45	188	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.54e-17	3	196	14	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	2.02e-16	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	2.03e-16	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.75e-16	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P58231	3.84e-10	45	188	150	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.575626	0.377310	0.012001	0.002644	0.001652	0.030767

TMHMM  Annotations     

start	end
5	27