CAZyme Information: MGYG000001363_01645

Basic Information

• Species: Streptococcus equinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus equinus
• CAZyme ID: MGYG000001363_01645
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		31938.09	7.6989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001363	1718648	Isolate	not provided	not provided

• Gene Location: Start: 47624; End: 48499 Strand: +

Full Sequence      

MLALLTGAVSAHEVKADVIVSGNTYKITARHSGKVLDVARGAKNAGANVQQWSDTNGTNQ
KWEFTKVNDCENTNPSDTTPTTTTGFHTSGTTLYDAKGNPFIMRGINYPYAWYKGQEDTA
IPAIARTGTNCIRIVMGDGRQYSKTSLAEIQKLLRLCKDNHLIAIVEAHDATGSDNIQDL
ENAANYWIEMKNVLIGNEANVILNIANEWAGSWDSSTWASGYQQVIPKLRNAGIKNTIVV
DCAAGDNIQNQLLMQVKVSFNLTHKRTSCSLFTCTNMLVPTVLYKTILTHH

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	95	250	1e-52	0.6324110671936759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.38e-16	94	241	1	166	Cellulase (glycosyl hydrolase family 5).
pfam14200	RicinB_lectin_2	2.82e-13	18	69	8	59	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	1.11e-06	18	52	55	89	Ricin-type beta-trefoil lectin domain-like.
cd00161	RICIN	3.54e-05	23	64	84	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
smart00458	RICIN	2.07e-04	23	65	78	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE21077.1	3.03e-211	1	291	11	301
VED90612.1	3.83e-132	2	243	12	347
VTS81291.1	3.83e-132	2	243	12	347
QGX44134.1	1.55e-131	2	243	12	347
QGX46302.1	3.10e-131	2	243	12	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WKY_A	7.89e-65	85	268	9	192	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
2WHJ_A	1.99e-62	85	243	2	160	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
2WHL_A	3.75e-62	85	243	1	159	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
3JUG_A	3.14e-61	85	243	24	182	Crystalstructure of endo-beta-1,4-mannanase from the alkaliphilic Bacillus sp. N16-5 [Bacillus sp. N16-5]
1BQC_A	1.43e-33	84	241	2	163	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1K3N4	1.09e-61	85	243	2	160	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1
B3PF24	1.44e-35	85	266	48	233	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P51529	6.78e-28	85	241	39	197	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
P22533	6.30e-21	105	241	55	195	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.186949	0.811797	0.000295	0.000454	0.000251	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001363_01645.