CAZyme Information: MGYG000001364_00344

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_00344
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001364_2|CGC2	41923.14	4.8929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 220230; End: 221333 Strand: +

Full Sequence      

MKRIIRYAGALLLAAGFVACSEWNVPERETFENQENLEKYIPLLEAESEADLTPSMRDYF
AKLREYRQTPHVKGFGWFGNWTGRGSNAQNYLKMLPDSVDFVSLWGTRGNLSEEQKKDLK
FFQEIKGGKALLCWIVQDLGDQMTPPGQDPKNYWIVEKGGGNFVEGVKAYANAICDTIEK
YNLDGFDIDYEPGYGHSGSMANGEIISENSGNTNMFVFIKTLSDRLRPAGRMLVMDGQPE
KLSTEASKYIDHYIYQAYWERSTAQVLRKINQPHLENWERKTIITVEFEQGWQTGGVDNY
TSVRPEINAYPEGCQIFDYATLDLPDGRRIGGIGTYHMEYDYANTPPYKWLREALHLGNV
VYPGKLD

Enzyme Prediction     

No EC number prediction in MGYG000001364_00344.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	1.97e-69	72	352	1	255	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam16141	DUF4849	1.06e-50	58	355	23	316	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd00598	GH18_chitinase-like	1.36e-06	167	258	89	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT38382.1	1.59e-209	3	367	2	364
ALJ42200.1	3.21e-209	3	367	2	364
BCA50050.1	3.21e-209	3	367	2	364
AAO76151.1	3.21e-209	3	367	2	364
QQA06635.1	3.21e-209	3	367	2	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	2.91e-204	3	367	2	364	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000045	0.999999	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_00344.