CAZyme Information: MGYG000001364_00490

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_00490
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		43441.53	6.0593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 391169; End: 392299 Strand: -

Full Sequence      

MRKILIAFLFIMSWGFTTSTAQKLPPQKETLEVMIKVNKYFMEKYADYRTPSFVRKVTRP
SNIWTRGVYYEGLMSLYSIFPRAEYYDYAYNWAEYHEWGMRNGNTTRNADDYCCGQTYID
LYNLCPKPEMLKNIKSNMNMLVNTPQVGDWTWVDAIQMGMPVLAKMGHLTGEQKYFDKMW
DMYEFSRNQLGGKGLFNLADGLWWRDADFLPPYKEPNGEDCYWSRGNGWAYAALVRVLDE
IPANEKHRQDYINDFLLMSKALKACQRTDGFWNVSLHDAGNYGGKETTGTALFVYGMAWG
VRNGLLDKEEYLPILLKGWNAMVKDAVHSNGFLGYVQGTGKEPKDGQPVTYESVPDFEDY
GVGCFLLAGTEIYKLQ

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	374	2.5e-89	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.80e-103	33	376	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.97e-50	41	375	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR73845.1	2.14e-231	1	376	2	377
ALA72223.1	2.14e-231	1	376	2	377
QJR69512.1	2.14e-231	1	376	2	377
AII66388.1	2.14e-231	1	376	2	377
AND18201.1	2.14e-231	1	376	2	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	6.20e-70	20	371	23	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.68e-62	28	371	14	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	6.55e-42	150	376	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
3K11_A	5.00e-14	143	375	192	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	9.34e-46	64	376	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	4.16e-41	150	376	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.36e-37	108	372	135	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000431	0.998572	0.000434	0.000189	0.000176	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_00490.