CAZyme Information: MGYG000001364_00594

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_00594
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000001364_2|CGC5	42937.38	7.0938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 535880; End: 536992 Strand: +

Full Sequence      

MKHFWMCACLLFSTLTVWGQTNFRKSEIKEVMKRVADWQIANPDKRHEHGDLDWTNAALY
MGMIDWAELAEKEDGNRAYYDWLLKIGRRNHFQMGKWMYHADFIAVGQPFIDLYQKYKEQ
KMITPVMARANWVVENMPMASMQLDYGKMETLTRWSWCDALFMAPPVYAKLYGQTLDRKY
LDFMNREYKATYDLLFDKEENLFYRDTRYIGKQEANGKKVFWGRGNGWVLGGLAEILKAL
PADEPSRKFYQELFVTLATRVAELQSADGYWHASLLDPASYPSPETSATGFIVYALAYGV
NQHLLDRDAFLLVLERGWKALTDAVEKNGKLGYVQPIGADPRKVTRDMTEVYGVGAFLMA
GCELYKMSEK

Enzyme Prediction     

No EC number prediction in MGYG000001364_00594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	366	2.5e-82	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.60e-96	31	367	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.38e-48	25	368	1	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59360.1	1.07e-209	11	367	12	368
QUT89583.1	1.07e-209	11	367	12	368
AVM53966.1	4.43e-204	22	370	20	368
QDO67620.1	2.08e-203	22	367	25	370
ASM65072.1	7.67e-192	10	368	12	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	6.80e-71	23	367	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.31e-59	26	369	31	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.06e-50	54	363	39	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	7.43e-17	157	367	200	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	1.64e-08	99	343	72	328	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.06e-74	14	369	20	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	4.53e-70	23	367	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.48e-65	25	364	54	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006406	0.992088	0.000706	0.000257	0.000247	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_00594.