CAZyme Information: MGYG000001364_00610

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_00610
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001364_2|CGC6	37005.11	8.6534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 560424; End: 561398 Strand: -

Full Sequence      

MKLTKRLYTLSLTTALFVTGFLLPGFSTSCTAQTETTPSSSPAYSCIEVPKSINFCGTEI
DLTRYDRRERMDRELMAFTYMHSTSLQIIKRANRYFPIIESILKEQGVPDDFKYLMVIES
NVNPLARSGAGAAGLWQFMSGTAREFGLEVNHHVDERYHVEKSTVAACKYLKQAYRKFGN
WETVAASYNAGQGRISQQQEKQYTDNALDLYLVEETSRYVYRILAVKLLLTDPARFGFHL
RASDLYPPIPYRTIKVTEDIDDLARFAKGQGINFSLLKSMNPWLRGSSLPNHGGKEYQIR
IPDSTEMYYNPRVTHPHNPAWVSE

Enzyme Prediction     

No EC number prediction in MGYG000001364_00610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	95	226	4.9e-25	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.71e-65	103	227	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.68e-28	98	204	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	1.40e-27	68	304	81	313	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	2.36e-21	115	225	7	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.54e-15	95	225	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24006.1	4.02e-163	44	324	42	322
ADY36030.1	3.34e-153	5	322	2	322
QUT56374.1	1.63e-136	44	324	52	332
QEW35083.1	9.37e-136	44	324	52	332
QQY40386.1	9.37e-136	44	324	52	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	6.22e-24	55	293	62	301	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	6.22e-24	55	293	62	301	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	6.13e-07	119	226	85	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.21e-06	119	195	1447	1518	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.21e-06	119	195	1447	1518	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003514	0.526905	0.467256	0.001654	0.000390	0.000265

TMHMM  Annotations     

start	end
7	29