CAZyme Information: MGYG000001364_00691

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_00691
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001364_2|CGC11	43183.29	6.7829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 669306; End: 670442 Strand: -

Full Sequence      

MNTLKIAYIGMGYRGKQLLALTRHIPYFQVTAIADPEAREADYDVPCYNQGGDDYQRMIA
LHAPQLVFIASPWQLHVTHALYCIQHGCHVALEIKGGLYLHEYQPLIEAAKAGKKKIFPL
ENTLFRQEILAMHNLVRAGELGEVVYMRGGYRHDLRNLLLDDQGNLGNRKKTESIWRSKF
YQQENGDLYPTHGLAPLCLIAGIPRKDRFVRLTTFSSKPAGLYQRIRELGGNPHVPVTQG
DVTVTQLETASGTLVSLTHDTTLPRPRSLDFEIQGTKGIWQGEQRRIYLEGKSPHETWEA
DTAYLQKYEHLYWQQWGEEALRIDTHHEGMDYIMLKALEAEMKQEIPYPADIHDLALWTS
VTPLSIRSVAEQHTVPME

Enzyme Prediction     

No EC number prediction in MGYG000001364_00691.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	374	1e-109	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.80e-20	1	378	1	341	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.30e-12	4	93	1	92	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	4.86e-193	2	375	8	382
QUT33801.1	3.20e-192	1	375	1	376
QQA30653.1	3.20e-192	1	375	1	376
QUT62197.1	3.20e-192	1	375	1	376
QRO24037.1	9.69e-156	1	375	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	6.23e-74	4	375	21	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.53e-44	1	378	40	429	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	3.41e-73	4	375	21	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	4.15e-66	4	370	34	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	4.28e-61	4	370	53	443	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4FN60	9.60e-61	2	378	59	437	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1
A6LB54	6.14e-60	4	370	50	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_00691.