CAZyme Information: MGYG000001364_01536

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_01536
• CAZy Family: GH16
• CAZyme Description: Beta-agarase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		36273.66	5.0089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 76329; End: 77279 Strand: -

Full Sequence      

MKRKLFTICLASLQFACAAENLNNKSYEWDIYPVPANAGDGMVWKLHPQSDDFNYIADEK
DKGKEFYAKWTDFYHNHWTGPAPTIWQRDHVSVSDGFLKIRASRPEDVPLKKVVSGPNTK
ELPGTYTGCITSKTRVKYPVYVEAYAKLSNSTMASDVWMLSPDDTQEIDIIEAYGGDRDG
GGYGADRLHLSHHIFIRQPFKDYQPKDSGSWYKDDKGTLWRDDFHRVGVFWKDPFTLEYY
VDGELVRTISGKDIIDPNNYTGGTGLVKDMDIIINMEDQSWRAVKGLSPTDEELKNVEDH
TFLVDWIRVYTLVPEE

Enzyme Prediction     

EC	3.2.1.81

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	51	310	3.2e-111	0.9959349593495935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02178	GH16_beta_agarase	1.21e-89	28	310	4	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	5.69e-22	51	310	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	9.88e-13	50	310	2	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDY95404.1	1.12e-248	1	316	1	316
BBK89488.1	5.62e-154	38	316	40	322
AXP07831.1	3.38e-139	23	316	25	323
AXP07836.1	9.82e-125	26	310	20	289
AIY13463.1	1.86e-116	19	314	46	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T9X_A	4.32e-155	38	316	61	343	Crystalstructure of BuGH16Bwt [Bacteroides uniformis],5T9X_B Crystal structure of BuGH16Bwt [Bacteroides uniformis],5T9X_C Crystal structure of BuGH16Bwt [Bacteroides uniformis]
3WZ1_A	1.75e-118	28	314	4	276	Catalyticdomain of beta-agarase from Microbulbifer thermotolerans JAMB-A94 [Microbulbifer thermotolerans]
4ATF_A	9.39e-110	25	315	10	307	Crystalstructure of inactivated mutant beta-agarase B in complex with agaro-octaose [Zobellia galactanivorans],4ATF_B Crystal structure of inactivated mutant beta-agarase B in complex with agaro-octaose [Zobellia galactanivorans],4ATF_C Crystal structure of inactivated mutant beta-agarase B in complex with agaro-octaose [Zobellia galactanivorans],4ATF_D Crystal structure of inactivated mutant beta-agarase B in complex with agaro-octaose [Zobellia galactanivorans]
1O4Z_A	1.16e-109	25	315	41	338	TheThree-dimensional Structure Of Beta-agarase B From Zobellia Galactanivorans [Zobellia galactanivorans],1O4Z_B The Three-dimensional Structure Of Beta-agarase B From Zobellia Galactanivorans [Zobellia galactanivorans],1O4Z_C The Three-dimensional Structure Of Beta-agarase B From Zobellia Galactanivorans [Zobellia galactanivorans],1O4Z_D The Three-dimensional Structure Of Beta-agarase B From Zobellia Galactanivorans [Zobellia galactanivorans]
6AII_A	1.11e-83	25	311	2	322	Catalyticdomain of PdAgaC [Persicobacter]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5CY73	2.24e-249	1	316	1	316	Beta-agarase OS=Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / M2) OX=484018 GN=BACPLE_01670 PE=1 SV=1
Q9RGX8	8.02e-109	25	315	56	353	Beta-agarase B OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=agaB PE=1 SV=1
D7GXG4	1.68e-82	1	310	1	373	Beta-agarase D OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=agaD PE=1 SV=1
G0L322	2.41e-77	28	310	22	284	Beta-agarase A OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=agaA PE=1 SV=1
A8W969	1.62e-53	12	310	8	296	Beta-agarase AgaB34 OS=Agarivorans albus OX=182262 GN=agaB34 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000866	0.572409	0.426008	0.000309	0.000213	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_01536.