CAZyme Information: MGYG000001364_01559

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_01559
• CAZy Family: GH86
• CAZyme Description: Beta-porphyranase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		69601.47	9.3065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 105011; End: 106834 Strand: -

Full Sequence      

MNNIILTALSVCLSFSVFPLSSSENKTYNTTVTVDYATQRYLNDVSALDRGKYFNIHTSK
DSDPDVRKFLADYGVGIGRSFWGPFSYSYGKTKKVGEYPFSEKPLNYTDLKETKRYVATE
HANARTIQWGIDPVKAGAWAAEYYSKHVKGAVPEFFEPINEPFVHARDKCFNMHGQEMRM
LMADFYAQTGKHIHAEPSLKKMKIIGYAAAYPAMELRDFDHWNNTMKMFIDRAGEYMDGL
SVHLYDGINIVGKSSRRSGSNSEAILDLMENYSFIRLGKVLPLAVTEYGGIDNTSKGYHP
IASVRTVASFNHILFNLLEREDKMLISIPFVSDKAEWHITKQYNFEPYGAALFVANNPYD
LKNTAWKLNDKKYFFKLWKDVKGERVDIVSDNPDIQVAAFKDDDRLYIAIDNLDDYTHKV
NLKNVLNWKGVDNVSVRSLKMIFDKGIVYDEKTLNSMPQSIDIIKDETIILCADISRKKY
SNRIVRTKYYSNTYLQPVEAGKPIVFDFDGLKPGTGRAVLRMSIGRKHEMSKKPEIMVNG
KKVDMPDNWRGYDQTGRDDFFGMIEIPFDYRLIRKGKNSVSVTFPDNGGRVATMILQTER
YDKKVRK

Enzyme Prediction     

EC	3.2.1.81

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH86	28	599	6.9e-167	0.9898477157360406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21510	agarase_cat	4.59e-102	50	379	1	321	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
pfam18040	BPA_C	6.44e-34	506	598	2	94	beta porphyranase A C-terminal. This is the C-terminal domain found in Bacteroides plebeius of proteins such as beta-porphyranase A (BPA), a beta-galactanase that cleaves the beta-1,4 glycosidic bond. Porphyranase degrade red seaweed glycans. This domain adopts a beta sandwich shape.
pfam18206	Porphyrn_cat_1	6.70e-22	394	496	1	105	Porphyranase catalytic subdomain 1. This domain is found in porphyranase protein present in Bacteroides plebeius. Porphyranase breaks down porphyran during digestion of red seaweed glycans. It is worth noting that red seaweed glycans contain sulfate esters that are absent in terrestrial plants. This domain makes up part of the catalytic domain of the porphyranase protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDY95428.1	0.0	34	607	1	574
EDY95427.1	9.68e-250	32	601	28	595
ANQ51878.1	9.09e-183	28	605	29	608
QWG04144.1	7.19e-182	28	605	29	608
AUP78946.1	4.49e-180	28	605	22	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AW7_A	4.47e-250	33	601	23	588	ChainA, GH86A BETA-PORPHYRANASE [Phocaeicola plebeius]
5TA1_A	2.29e-83	30	606	25	647	Crystalstructure of BuGH86wt [Bacteroides uniformis],5TA5_A Crystal structure of BuGH86wt in complex with neoagarooctaose [Bacteroides uniformis],5TA5_B Crystal structure of BuGH86wt in complex with neoagarooctaose [Bacteroides uniformis]
5TA0_A	6.25e-83	30	606	25	647	Crystalstructure of BuGH86E322Q in complex with neoagarooctaose [Bacteroides uniformis],5TA0_B Crystal structure of BuGH86E322Q in complex with neoagarooctaose [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5CY96	1.94e-250	32	601	28	595	Beta-porphyranase A OS=Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / M2) OX=484018 GN=BACPLE_01693 PE=1 SV=1
P13734	3.04e-32	153	420	192	456	Beta-agarase OS=Pseudoalteromonas atlantica OX=288 GN=agrA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000768	0.995872	0.002758	0.000197	0.000195	0.000188

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_01559.