CAZyme Information: MGYG000001364_01821

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_01821
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000001364_6|CGC3	36468.78	6.3775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 427060; End: 428019 Strand: +

Full Sequence      

MCNVNESPGNVIYCNLYAWCVFLYGLNFKSMDKHSFFIALWVLCFIPVSLFSRSRVVNDT
IFSKKLNAERTCSVYLPPSYGEVPGKKYPVLYLFHGMSQTNQDWVWRGHVQEVADRLIYS
QEAREMIIVMPDAGGDIYKEIWNGFFNMSGWLYEDFFFEEFLPYVENKYHVIGNKENRAV
AGLSMGGGGATGYGLWHADKFASVYAMSALMSIPEEGAARFDNPDSKLAILTRAVIERSC
IKRVINADAGTIQALKSVRWFVDCGDDDFLLDRNIEFFQAMRKAGIPCQFRVRDGGHDWE
YWHSALYLCLPFVSGTFSK

Enzyme Prediction     

No EC number prediction in MGYG000001364_01821.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	63	312	1.1e-56	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	3.21e-30	51	306	63	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.83e-24	63	306	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.88e-20	73	317	38	312	S-formylglutathione hydrolase FrmB [Defense mechanisms].
PLN02442	PLN02442	2.05e-07	52	304	9	262	S-formylglutathione hydrolase
COG2819	YbbA	1.96e-05	63	208	16	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ79787.1	2.57e-30	56	311	139	379
VTS04162.1	1.85e-29	63	313	68	291
VIP03395.1	1.85e-29	63	313	68	291
QNL47921.1	7.09e-29	54	308	40	271
AEJ20917.1	7.95e-29	56	306	38	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	3.27e-132	53	319	9	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
1JJF_A	4.33e-26	53	307	29	251	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.16e-25	53	307	29	251	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.16e-17	62	306	145	377	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	2.14e-17	51	313	122	384	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	7.43e-24	53	307	48	270	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.25e-16	62	313	437	668	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.12e-14	56	224	143	322	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P23553	1.31e-14	56	314	3	262	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
D5EY13	2.88e-12	52	306	496	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999978	0.000027	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	28
35	57