CAZyme Information: MGYG000001364_02096

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_02096
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		70965.18	5.0888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 7369; End: 9252 Strand: -

Full Sequence      

MRKSIHLLSIPVVACCLSCTSGKVLPPEPILPVPEPKQVEWQQMETYAFIHFGLNTFNDR
EWGYGDTDPKTFNPTNLDCEQWAQTLVKAGMKGVILTAKHHDGFCLWPFEGTDYSVKNSP
WKNGQGNVVKELSEACKKYGLKFAVYLSPWDRHQANYGTPEYLPYFYAQLHDLLTNYGPV
FEVWFDGANGGDGWYGGAKDIRTIDRKNYYNYPRIYEMLDSIQPQAIIFSDGGPGCRWVG
NEKGFAGATNWSFLRKGEVHPGYDKSYELQYGHPDGNQWVPAECDVSIRPGWFYHPEEDD
RVKSPDQLVDLYYRSVGHNATLLLNFPVDRRGLIHPVDSANAVRFHEMIQQQLKTNLVAG
MTPKVSNERGGDFVASALTDDNFDTYWATEDGVTTADIEFSFDTPTRMNRMMLQEYIPLG
QRVKAFVVEYLDKDTWLPVKLNEETTTIGYKRLLRFETVETKGIRIRITDARGPLCLSSV
GVYDAGNVSDSFVEKVEDIESLPYLLPDVKTDEAAKASDKQAQTTCFVEGDRLLIELQEE
RLVSSLHFLPDQGEPNKGLIANYEIRVGVSKDAVNQLVKSGEFSNIQNNPVMQSVFFTPV
KARYIELKATRMIRAGEPMGFAELGVK

Enzyme Prediction     

No EC number prediction in MGYG000001364_02096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	29	347	1e-81	0.8728323699421965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	9.46e-68	27	483	4	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.74e-40	61	337	69	316	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.69e-34	49	337	31	318	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	2.55e-10	364	470	3	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam14871	GHL6	0.001	78	153	1	74	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25194.1	0.0	1	627	3	629
QUT25029.1	0.0	18	627	17	624
QUR44165.1	0.0	18	627	17	624
QUU10154.1	0.0	27	627	26	626
ASM67455.1	0.0	27	627	26	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.04e-169	28	626	33	583	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	7.93e-136	33	626	31	582	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	6.01e-118	33	483	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	2.32e-110	34	472	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	2.83e-108	34	472	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	4.66e-118	26	492	32	480	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	6.41e-115	27	483	31	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q9BTY2	3.43e-09	41	190	78	232	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q5RFI5	7.90e-09	41	190	76	230	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
P17164	7.34e-08	41	337	77	346	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002127	0.256436	0.740125	0.000436	0.000463	0.000407

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_02096.