CAZyme Information: MGYG000001364_02179

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_02179
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	MGYG000001364_9|CGC3	60813.87	4.7412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 32341; End: 33966 Strand: +

Full Sequence      

MNHKNYMYVWGLGALFALSSCSSELDIPEAPVYNRERSLTVTLNQEFQTIDGFGASDAWR
CQMVGRYWPEEKKNAIADWLFSHEFDENGNPKGIGLSMWRFYIGSGSMEQGAESGIADEW
RRAECFQSADGTYDWEKQAGQRWFLRAARDRGVGRFLAFSLSAPVHMSLNGKGFSTPEQR
MNIQEGKMPAYADFLVDCIENLQKKEGVTFNYLSPVNEPQWDWSSGSQEGTPVTNEEMHQ
FVTLLSERLSQRGLSTTIALGEAGSINYLYQDVNAENRDNQIEAFWNPSSSLSIASLPNV
EKVMTGHSYWSVWPLEDMISHRRNLSTKIGTYSGLKYWQTEYCPMESPGTSEVPNGDGNV
RDLGMQTALYVARIIHHDLTYANASSWQWWTALTRANYKDGLIYLDDGNSEGGQSAGYCK
EDGYARDSKLMWAFGNYSFFVRPGMKRVAVTTDSSDPLNEAKDVMISAYKDEAAGKLVIV
AVNIGKVNREYHLNTDCKLKNQTLVPYVTSENSNLAKGTEMPVDELSIPARSVVTFVGEI
E

Enzyme Prediction     

No EC number prediction in MGYG000001364_02179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	39	537	1e-199	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	6.41e-172	36	404	1	367	O-Glycosyl hydrolase family 30.
COG5520	XynC	3.04e-18	21	541	14	431	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60402.1	5.84e-305	1	541	1	540
QUT88592.1	5.84e-305	1	541	1	540
QDO68591.1	3.37e-304	1	541	1	540
SCD20877.1	2.73e-271	12	541	11	543
APA00119.1	5.41e-223	15	538	16	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	3.45e-113	47	539	16	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	1.25e-22	15	537	1	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
6IUJ_A	1.54e-19	33	541	18	474	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.10e-19	25	541	82	545	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	7.65e-16	38	485	4	388	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	3.57e-16	15	485	5	412	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000443	0.999615	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_02179.