CAZyme Information: MGYG000001364_02404

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_02404
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
955	MGYG000001364_11|CGC1	110350.64	7.8098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 8649; End: 11516 Strand: -

Full Sequence      

MRKHIFVFYLLLITQLLHAQNVIDLAGEWSFQIDKENKGIDEKWYAHPLNDKINLPGSMP
EKLKGERPSLQTQWTGSLYDSSFYYNPELEMFRRTGNVKFPFFLTPERRYVGAAWYKREI
HIPSSWKGKRVMLFLERPHIETTVWINNQRIGSQNSLSTPHEYDITAAVRPGTSTLTLRI
DNHDNCAKVGQNSHSITDHTQGNWNGVVGRMYLYVLPEISFKDIQVFPEPDKQQARVRMV
IQGHKSPVKLSLKAESFNSGIPHHVPEITQAFSKNDLKDTLEMVLPMGKDVQLWDEFHPT
LYKLTATLTQANQSDTREVEFGMRTFTIQGRWFYVNGRKTMLRGTVENCDFPLTGYPPMD
VESWERVFRICRKYGLNHMRFHSYCPPEAAFKAADRVGFYLQPEGPSWPNHDVRLGQGQY
IDQYLLEETIRMTQRYGNYASFCMLACGNEPSGNWVPWVSRFVDYWKAKDSRRVYTGASV
GGGWAWQPKSQYHVKAGVRGLNWKSKRPETMTDFREYLDTVKQPFVSHETGQWCVFPNFN
EIKKYTGVNKAGNFEIFQHLLHTHGMEGKGQDFMMASGKLQALCYKHEIERTLRTPDYAG
FQLLALNDYSGQGTALVGILDVFFEEKGYISAEEWRRFCAPTVPLLRTEKFVYTTNETFH
ANIEIAHFGAEPLQAAKVSYRITDAYGKVYSHGVIGQTDIPIGNLNHIGQVDFPLKDIPS
AMKLNIEVQVEGTDAVNDWDFWVYPESVDFASDETIYQTDTLDNKAREILEKGGKVLIKA
GKKVTYGKEVVQYFTPVFWNTSWFKMRPPHTTGILLNPHHPLFREFPTEYHSNLQWWELL
NRAPVMQFSDFGKDFQPLIQSIDTWFISRKIGVLFEANVLNGKLIMTTLDLDSAPEKRIV
ARQLKKSILDYMNSDNFHPEQRVEIQQVQELFTKVAGSPMLYTKDSPDELKPKIK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	717	3.1e-75	0.699468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.41e-26	22	478	12	433	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.60e-19	21	344	11	296	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	3.71e-18	25	217	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	1.39e-12	116	450	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.45e-08	219	324	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW35558.1	0.0	17	954	17	954
ALA72226.1	0.0	17	954	17	954
QQY39766.1	0.0	17	954	17	954
AII66391.1	0.0	17	954	17	954
QUT56820.1	0.0	17	954	17	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K4A_A	1.76e-17	19	355	11	305	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
6S6Z_A	2.29e-17	18	450	34	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.29e-17	18	450	35	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
4JHZ_A	5.33e-17	19	355	11	305	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	5.36e-17	19	355	11	305	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.25e-16	18	450	35	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P05804	6.71e-16	19	355	9	303	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	1.20e-13	97	408	41	350	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
A3FEW8	2.94e-12	18	450	49	463	Beta-galactosidase OS=Enterobacter agglomerans OX=549 GN=lacZ PE=1 SV=2
A4W7D2	2.94e-12	18	450	49	463	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000284	0.999058	0.000199	0.000152	0.000146	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_02404.