CAZyme Information: MGYG000001364_02440

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_02440
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907	MGYG000001364_11|CGC3	103521.27	5.644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 57228; End: 59951 Strand: +

Full Sequence      

MKNASLIVSAVLWLCGCLSMMAAGNKVYVVQSPDKQLKVEISAGSDGLNYSVYHKDSLIV
VDSRLGLIREGKTPALAGGAKVISAKTKKIFQDIDAPFYRFKSFQAVCNEMNLKLRGDYG
VYFRVYNEGVAYRFYTSSKENLIIKNEIAEFRFAGNYTAYLPYSTNKEKPMAMAFQNTYE
VKPLSEAPQELAFLPVTVDCKQAKVTLLESDLEAYPGMFVQPDGKQTLKGVFAPYPKKTD
FYPWRKQEYVTEAENYIARVKGNRTYPWRILAITEKDTEMPVNNLVYALSSPNRIGDCSW
VKPGKVAWDWWNDWNLKGVPFKAGINMDTYKYYIDFASRNGLEYVVLDEGWYDPKSGDML
TVIPELDLPELIRYGKSKGVELVLWTVFNVLDSQLDEACRKYAEMGIKGFKVDFLDRDDQ
TAVEMIYRIAAKAAEYKLILDYHGIYKPTGLNRTYPNVVNYESVFGMEEMKWSEVEKNMP
LYDVTFPYIRLMAGYVDYTPGAMRNLSKRDFQPMYSSPASMGTRCHQLAAYIVHDSPFTM
LCDAPTNYLKEQECVDFISSIPVETDSTFIYSGKLGESIVTVRKKDINWYIGGMTNWDER
EVTLDFSFLGEGEKYQCTLFKDGVNASRQAEDYVKETFVVDAHTRLPIHLASGGGFALKL
ERTFVTEVKPSAVPAGKGIPSFYKKYLEVDGLYIVSSDKVRDEALEKAYEIVSLMLAKRP
DIKRHMVSKGCHVMIIGEHEEVCDLPEYAHICNTPENIAFWNKRARGFGGAPEDDFSASC
GEENVLAFPGDKYVGENILIHEFAHLFHTIGIVGVEPEFNERLEQCRQNAIAKGLWKDTY
AISNKEEYFAECVQSFFNCNRYSETPNKVHNAMNRRTKLKSYDPDMYQLLKEYFYEIEIP
ILNEVHP

Enzyme Prediction     

No EC number prediction in MGYG000001364_02440.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	18	660	3.1e-190	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.47e-135	297	562	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.94e-58	32	292	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.49e-39	566	660	2	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd20169	Peptidase_M90_mtfA	1.34e-07	789	894	107	208	Mlc titration factor A (MtfA) is a zinc metallopeptidase (M90 peptidase). This subfamily includes the Mlc Titration Factor A (MtfA; also known as YeeI or DgsA anti-repressor MtfA) which is involved in the control of the glucose-phosphotransferase sensory and regulatory system by inactivation of the repressor Mlc (making large colonies). It can cleave synthetic substrates of both carboxypeptidases and aminopeptidases, with strongest activity towards the latter. Its biologically relevant substrate has yet to be identified. Although it interacts with the transcription repressor Mlc, it does not cleave it. However, Mlc seems to activate the peptidase activity of MtfA. MtfA is related to the catalytic domain of the anthrax lethal factor which is a zinc-dependent metalloprotease, targeting mitogen-activated protein kinase kinases (MAPKKs), and resulting in apoptosis, as well as the Mop (modulation of pathogenesis) protein involved in the virulence of Vibrio cholerae; although sequence similarity is low, conservation is observed in the overall structure as well as in the residues around the active site.
cd20170	Peptidase_M90-like	5.90e-05	797	891	117	206	uncharacterized M90 peptidase family-like proteins. This subfamily contains uncharacterized M90 peptidase-like domains, similar to the Mlc Titration Factor A (MtfA) peptidase from Escherichia coli, also known as the YeeI gene product, which is involved in the control of the glucose-phosphotransferase sensory and regulatory system by inactivation of the repressor Mlc (making large colonies). E. coli MtfA has been shown to have aminopeptidase activity with the presence of a single zinc ion in the active site ligated by two histidines in an HEXXH motif. MtfA is related to the catalytic domain of the anthrax lethal factor and the Mop protein involved in the virulence of Vibrio cholerae; although sequence similarity is low, conservation is observed in the overall structure as well as in the residues around the active site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38815.1	0.0	22	906	24	906
QQY38934.1	0.0	22	906	24	906
QEW34704.1	0.0	21	906	23	906
QJR66042.1	0.0	21	906	23	906
QJR70731.1	0.0	21	906	23	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	8.94e-199	32	661	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.61e-197	32	661	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	6.96e-60	30	661	3	659	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	1.77e-59	30	661	3	659	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	4.48e-59	30	661	3	659	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	3.11e-199	12	661	7	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	2.57e-44	23	657	30	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	1.84e-43	17	676	14	734	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000043	0.030533	0.969446	0.000010	0.000015	0.000013

TMHMM  Annotations     

start	end
7	29