CAZyme Information: MGYG000001364_02550

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_02550
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000001364_13|CGC1	89191.37	6.9256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 42595; End: 44904 Strand: -

Full Sequence      

MKQVFKLLLACAVGVLPMSVGARGSEAVEVRKMIDKVNQHWQAENSPEVRSFWDNAVYHT
GNMEAYFLTGNETYRTYSETWANYNQWKGAKSDNRAEWKYSYGESDEYVLFGDYQICFQT
YTDLYNLAPDDKKIKRAREVMEYQMSTPQHDYWWWSDALYMAMPVMTKLYKVTHNAKYLD
KLYEYLIYSDSIMFDKDENLYYRDAKYIYPKHKTVNGKKDFWARGDAWVLAGLAKVLQDL
PVEYKHHQFFVDKFQNMAKAVAAIQQPEGYWTRSMMDPEFAPGPETSGTALFTYGFLWGI
NNGYLEKDIYMPVVQKAWNYLSKKALQKDGAVGYVQPIGEKAIPGQVINAKSTANFGVGA
FLLAACEYVRYLEAPQTADRAYWCKLAYQMAYPVLSNMAKGELQKNMQLEVSPTWDGRNK
KVAYMETFGRLMAGIAPWLTLPDDDTEEGKMRKELREMALKSYANAVDPQSPDYLLWRQE
GQTLVDGAYVAESFLRAYDQLWKPLDETTKKRYIEEFQQLRRIDPPYTNWLLFSSTIESF
LAKAGASFDEYRVNSAIRKVEEWYTGDGWYADGPSFAFDYYSSYVFHPMYLETLQAMKDA
KVRSRIDYGKYYDRALKRAQKYSLILERFISPEGTFPVFGRSIPYRMATMQPLALMAWYQ
ELPAGVSSAQVRCALTAVMKRMFASGHNFNEGGFLTIGFTGRQPNVADWYTNNGSLYMTS
LAFLPLGLPASHPFWTDAPQEWTSVRAWGEKPFPKDHHWKDEIRTWDLF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	379	740	1.4e-106	0.9942528735632183
GH105	44	370	2.4e-78	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	8.20e-160	379	742	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	3.26e-97	29	372	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	7.60e-73	419	743	50	368	Uncharacterized protein [Function unknown].
COG4225	YesR	2.61e-39	53	370	36	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36172.1	0.0	1	769	1	770
AND21736.1	0.0	1	769	1	771
AII65647.1	0.0	1	769	1	771
QEW35177.1	0.0	1	769	1	771
ALA75973.1	0.0	1	769	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	6.91e-188	25	374	28	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.63e-168	29	373	15	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.21e-51	53	370	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.79e-14	37	367	25	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.88e-13	37	367	15	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.12e-51	53	373	58	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.44e-50	53	370	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	1.40e-37	153	367	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.63e-13	37	367	25	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998881	0.000235	0.000188	0.000172	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_02550.