CAZyme Information: MGYG000001364_02716

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_02716
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000001364_14|CGC3	38348.59	7.2232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 91151; End: 92176 Strand: -

Full Sequence      

MPWVDLSSHVEKQIVIAEGTEAIYNGHPTTVLMDDGKTILCTWSLGHGGKAAFIAKSNDG
GLTWHTDRAPEHWNVMRNCPSIYRLSDKQGKERLYVFCQEPLMGYSYSEDNGQTWSEIQS
LKKPCVMAFSSIVKLSNNDYLGVYHRGWNDQDRAPLTLWSAISHDGGLNWTPSVKIAEVE
GRSPCEPCVFYSPDKKQLVCIARENNRVGNSLMMFSNDEGKTWSAMRETPWGVTGDRHVA
RYLKDGRLLIAFRDMAPDSPTKGHFVAWVGTYKDLIEGTSGQYRIKLLHSYAGSDCGYPG
LEVLPDGTIVAITYVKYKPGKKLHSIVEVRFKLDETDNMLK

Enzyme Prediction     

No EC number prediction in MGYG000001364_02716.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.97e-24	57	314	52	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.36e-13	55	309	23	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	6.35e-12	26	174	112	255	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.78e-11	25	209	147	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	2.43e-08	130	313	17	216	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU73633.1	2.99e-114	1	341	204	546
QDV35524.1	7.31e-89	1	339	39	381
ABG82852.1	1.46e-62	1	341	199	568
SQG39657.1	1.46e-62	1	341	199	568
QUD71963.1	1.46e-62	1	341	199	568

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_02716.