CAZyme Information: MGYG000001366_01857

Basic Information

• Species: Succinatimonas hippei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinatimonas; Succinatimonas hippei
• CAZyme ID: MGYG000001366_01857
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000001366_130|CGC1	40717.96	7.8047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001366	2304998	Isolate	not provided	Asia

• Gene Location: Start: 7194; End: 8261 Strand: +

Full Sequence      

MAGSAYLGVIEGFFGKSYGYTKRSHLLDFLHKNNYSFYIYAPKEDKFLRSDLSESMPEAK
ISELSFLGQKSRILNIDFGIGISPLNLSSSFDSLRNKLLQRIDSYTKRTNSVILALLFDD
VKLEDPHIGFLQNKIIKDVYDNMPSRIKRLIVCPSYYSEDPILDRVFGKRPEHYFTELTA
SLPSDIDIFWTGPKVLSQDITENDILRATELLGRKPFIWDNYPVNDGKNIADFLFLSAFK
GRRNLLGKIEGHAVNPMLEMYLSYPALTTLPLIYKNLSDSAIKDAWLKCLNDIFKDKTKL
ILENQKFFEKEGLSKISQIHKDELLSKLINDSSPAVLELKDYLLGKYRFDPACLT

Enzyme Prediction     

No EC number prediction in MGYG000001366_01857.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	8	299	3e-65	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	9.38e-52	8	270	2	258	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QET77871.1	1.55e-75	4	355	14	366
QQB20637.1	3.10e-75	4	355	14	366
QMS77852.1	4.37e-75	4	355	14	366
QWL58486.1	6.18e-75	4	355	14	366
AXV20018.1	8.72e-75	4	355	14	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DIY_A	9.53e-31	6	314	6	314	Thermobaculumterrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum],5DIY_B Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum]
7KHS_A	7.68e-25	3	269	1	270	ChainA, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_B Chain B, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_C Chain C, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_D Chain D, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516]
2XSA_A	3.57e-24	8	269	4	268	ChainA, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516],2XSB_A Chain A, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516]
5UHK_A	2.77e-23	8	284	8	287	Crystalstructure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHK_C Crystal structure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHL_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHL_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHO_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens],5UHO_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens]
5UHP_A	4.65e-23	8	284	51	330	Crystalstructure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_B Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_C Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_D Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],6PM9_A Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_B Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_C Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_D Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2CEE3	1.95e-23	8	269	4	268	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
O60502	1.02e-21	8	284	63	342	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
Q9EQQ9	1.02e-21	8	284	63	342	Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Oga PE=1 SV=2
Q8VIJ5	1.37e-21	8	284	63	342	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1
Q0TR53	2.30e-18	8	353	183	536	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001366_01857.