CAZyme Information: MGYG000001368_00649

Basic Information

• Species: Muricomes fissicatena_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes fissicatena_A
• CAZyme ID: MGYG000001368_00649
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	MGYG000001368_1|CGC9	94498.25	5.7814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001368	5374587	Isolate	not provided	not provided

• Gene Location: Start: 752411; End: 754813 Strand: +

Full Sequence      

MKNDRRLMQFYFITEGEKSTHYHQNPELFYVLAGELTASIDDQIFRMKQGDILLINANKH
HMMDGNQDVLAARFEIDFHLLAEHMGTMQLLFWCNTLVDKNAAYQQLRNYLDQIMLRYFE
KDEKNELHLNALYYECLHLLTGNFLVKMDDARFHIESSQDKQRISQIQNYVQANYQSQIS
LNDLADRLFLSNAYLSKYIKKNLSLTFMEYLNNVRLFHAVDELLYTQKNMTHIALDNGFP
TSAAFTKAFKDVYGEAPSEYRKRLQNQEMSGEPDRDVTERELKQIQKYLELKAKKKEPET
KNMQIYQIDTLQPGTKLSNGFRTVCIGEAYQILHSDVQNQIRELKSETDILYARIWNIFS
REECVSESGKCNFRKIDMVLDFLVENHIKPYLELGHKETAFMYSPERVLKEYEKIGHYSK
EMFEGIMQEFGTHLVNRYGIEEIETWYFEYWNNNLYEMEKEDGQYYHYFETVFRVLKEIS
SQIRVGGAGFILGYDTVPCLEILKIWKQRKYQPDFLSVYSYQYTAAMEAGKRYGRKSIDV
DYMKNQVAIMKNVIRDVGIEVKELHITEWNFTISNRNQINDSCEQGAYVLKNCIDMNGEV
DLMSYWHALDSYSDYYDTNDILNGDSGLISRDGIYKPAFHAFAFMKRLQPDVIKKEEYAI
VTTNGRGHFTIACHNFKQLSAHYVFKDEEQIALEEIDSYTGNAEPLKLKFALNHVKNGIY
QVKIYYVNRENGSAQDIWKRLEYGKNLTKDEMNYLRKSAIPRIEMHSISVENETLELENI
LMEQEIRLLDIRYQYTVQQE

Enzyme Prediction     

No EC number prediction in MGYG000001368_00649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	323	741	1.1e-60	0.9559164733178654

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.86e-30	307	764	4	460	Glycosyl hydrolases family 39.
COG2207	AraC	1.51e-25	154	266	12	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
COG3664	XynB	2.53e-25	332	792	1	425	Beta-xylosidase [Carbohydrate transport and metabolism].
smart00342	HTH_ARAC	1.50e-22	178	261	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	3.30e-21	184	263	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58080.1	1.49e-194	3	793	6	800
AQR96769.1	1.18e-193	3	793	6	800
AQR96727.1	1.02e-149	17	796	16	795
BBG22497.1	1.04e-149	18	791	20	805
QQQ92191.1	6.05e-134	18	791	17	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W91_A	4.69e-32	372	791	78	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	1.13e-31	372	791	78	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	2.04e-31	372	791	78	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
4M29_A	3.85e-29	321	775	25	481	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	6.91e-29	321	775	25	481	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	8.82e-30	372	791	78	481	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
Q936F1	1.39e-29	30	792	27	740	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2
Q6GKK1	7.52e-29	30	792	27	740	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
O30360	2.18e-27	333	773	31	460	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
Q5HJR8	6.71e-27	30	792	27	740	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001368_00649.