CAZyme Information: MGYG000001368_00836

Basic Information

• Species: Muricomes fissicatena_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes fissicatena_A
• CAZyme ID: MGYG000001368_00836
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000001368_1|CGC11	64189.39	4.9966

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001368	5374587	Isolate	not provided	not provided

• Gene Location: Start: 976541; End: 978223 Strand: +

Full Sequence      

MKLNFGAVPFSYAGSYMAFSYPQDKARGYEKNLTLRTLFGMFDDQQNFPIYLRDPEGNIL
DGDVTACETELSLSHGKYYLKICFQNADTIIFRANTQVVITKRRLSGSERVMVHDYGMCE
IAGDEESLALEISKGSFTDHSVLNEKENPILKVLLKPAGDRLEGQLTLTGLNYKRPPQCS
YEEALCETVKSYKAATETISTTCKKYQEAMAEAAYINWHAIVNPNGYIKYPVMLMTKNVM
NQVWSWDYAINALAMADKNPELAYQQFLAMIECQDPHGTYPDCFQARTMIRSYVKPPIQG
FILQKMFEIKMPGNDILKRLYQSVTQLTNWWIDFRGRKDGIPEYNHGNDSGWDNSTVFRC
GYPVKSPDLCAWLVEQMYFLSRTARLLGLIEESEDWAKRGEALLAKMLEYFVVDHTFAAY
KEPEHKVVENNSLLLYIPLILGERLPEDLRKNMLDKLLTSGKFITDYGIASEPVDSEYFI
EDGYWRGAIWPPTAFIMTELLMKNGKTEEALKNAESFCDLCAERGFYENYSAIDGRGLRD
SGFTWTASVFMILLRDYLEK

Enzyme Prediction     

No EC number prediction in MGYG000001368_00836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	236	558	1.7e-37	0.37719298245614036

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	4.28e-23	244	560	285	606	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	1.17e-07	294	553	155	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL03490.1	1.94e-193	2	558	7	570
QRV18358.1	1.94e-193	2	558	7	570
SET49170.1	5.13e-191	2	558	7	570
QIZ06325.1	1.98e-110	8	553	7	555
QIB27034.1	7.69e-109	1	557	1	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.27e-06	217	560	293	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	5.03e-06	217	560	293	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	6.62e-06	217	560	293	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	7.02e-06	217	560	316	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001368_00836.