CAZyme Information: MGYG000001369_00224

Basic Information

• Species: Lactobacillus delbrueckii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus delbrueckii
• CAZyme ID: MGYG000001369_00224
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000001369_1|CGC2	54516.48	4.9498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001369	1875811	Isolate	not provided	not provided

• Gene Location: Start: 245705; End: 247150 Strand: +

Full Sequence      

MYSAKMPEGFLWGGAVAAHQIEGAWDVGGKGVSVADVMTVGSATKPREITDGVLPGKNYP
NHSAIDFYHRYKEDIKLLAGMGFKAFRTSIAWTRIFPNGDDAEPNEAGLKFYDDLFDEMH
KYGIEPVITLSHFEMPFNLAKNYGGFTNRKTIDFFVRFAEVCFKRYKDKVKYWMTFNEIN
NQSAFNNDFLMATNSGILFKEGMTDEEKEAAMYQAAHYEFVASALAVKIGHKINPDFKIG
LMINYSPVRPLTPSSEDTLLADKFEQHRDFFSDVQVFGEYPKAIEAYIEKHGYRPDITDE
DRVVLKEGTVDYVAFSYYQSTTVSSEKVSADELSDLEKAVAVNPTLERSDWGWEIDPVGL
RLALNHLTDRYHLPLFIVENGLGAYDKVEDGKIHDPYRVDYLKKHISEMEKAVTIDGVDL
MGYLPWGPIDLVSAGTGQMDKRYGFIYVNKNDQGVGDLSRTPKDSYYWYKKVIASNGTDL
D

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	477	1.3e-152	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	480	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	7	481	5	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	480	1	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	481	3	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	7	481	7	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW12132.1	0.0	1	481	1	481
APG66891.1	0.0	1	481	1	481
ADQ61168.1	0.0	1	481	1	481
APG74836.1	0.0	1	481	1	481
APG73412.1	0.0	1	481	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.67e-228	4	480	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.77e-228	4	480	5	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	9.40e-221	4	480	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	1.70e-209	7	481	12	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	3.00e-207	6	480	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.64e-206	6	480	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	3.83e-205	5	480	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	3.90e-178	5	480	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	7.72e-159	2	481	3	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	5.28e-157	7	480	5	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001369_00224.