CAZyme Information: MGYG000001369_00555

Basic Information

• Species: Lactobacillus delbrueckii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus delbrueckii
• CAZyme ID: MGYG000001369_00555
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000001369_1|CGC4	33902.99	4.8547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001369	1875811	Isolate	not provided	not provided

• Gene Location: Start: 615125; End: 616072 Strand: +

Full Sequence      

MSSLSQKLASLFLIDSTGDFTENLRLLEQYQPAGLLLFAKDLAGLSEKAVKERLAIYRQA
RPGLLLAIDQEGGLVSRLSALYPNRSYPSQAELLKKGADFFLAESQKTALELKDLGINLN
FAPVADLSLDPASFIYSRTLQAGAEETGPAIAAFIKLYRQLGVASCAKHFPGYGDAGDTH
QAPAKDLRSLKEAQLDLLPFKAAIAASVPTIMVAHLEVACYSPGPASLSPEIYRLLKEDL
HYFGVAITDDLAMAAARESSCPELLALKAGADLLLGGKLENLPILEAAAESGELPKERIK
DALVRVQTLQDDYSL

Enzyme Prediction     

No EC number prediction in MGYG000001369_00555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	275	1.2e-37	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.71e-49	3	315	2	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.31e-47	3	309	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.61e-31	22	275	16	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.82e-07	109	306	143	349	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW12439.1	9.63e-220	1	315	1	315
APG75127.1	1.12e-218	1	315	1	315
APG68851.1	3.22e-218	1	315	1	315
ASW64331.1	3.22e-218	1	315	1	315
ARR37170.1	1.86e-217	1	315	1	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VI6_A	8.23e-31	27	311	21	311	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
5G1M_A	7.04e-30	14	273	29	291	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
5G5U_A	1.86e-28	14	273	29	291	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
6K5J_A	2.33e-27	4	310	13	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.67e-24	26	310	80	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7UYS5	2.72e-29	14	273	9	271	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=nagZ PE=3 SV=1
Q02PG9	2.72e-29	14	273	9	271	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=nagZ PE=3 SV=1
Q9HZK0	2.72e-29	14	273	9	271	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nagZ PE=1 SV=1
Q606N2	3.91e-28	34	275	24	271	Beta-hexosaminidase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nagZ PE=3 SV=1
Q5H1Q0	1.88e-24	33	256	25	254	Beta-hexosaminidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) OX=291331 GN=nagZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001369_00555.