CAZyme Information: MGYG000001369_01493

Basic Information

• Species: Lactobacillus delbrueckii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus delbrueckii
• CAZyme ID: MGYG000001369_01493
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217	MGYG000001369_1|CGC21	24560.2	10.3423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001369	1875811	Isolate	not provided	not provided

• Gene Location: Start: 1584530; End: 1585183 Strand: +

Full Sequence      

MAGHRKTRKGKQTTTILVVRVFAIILLCLGLFVAFRYYRRQALQQEQIRQAELAKQEAAA
KLLRQKKAFIQKVGPISQKVDKGTGLLPSITIAQACLESNYGQSALSQKYNNLFGVKGTN
PNTSAVMTTKEYSNGKWVTVKARFQIYDSYEASIRAHVRLFQQGTSWNKDQYKDVLAAKD
YKSQAKALVTDGYATDPDYSTKLINLIEQYNLNKYDN

Enzyme Prediction     

No EC number prediction in MGYG000001369_01493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	75	212	6.4e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.46e-62	54	217	31	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	9.94e-36	67	216	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	3.23e-33	65	217	319	473	amidase domain-containing protein.
PRK05684	flgJ	4.13e-30	41	209	127	296	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.45e-28	68	216	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ60457.1	3.69e-150	1	217	1	217
ASW11551.1	3.69e-150	1	217	1	217
APG69812.1	3.69e-150	1	217	1	217
ASW63391.1	3.69e-150	1	217	1	217
APG67445.1	3.69e-150	1	217	1	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.41e-26	69	216	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.69e-17	69	216	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.32e-16	67	209	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.82e-16	67	209	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.29e-15	68	207	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.23e-38	65	216	47	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	3.35e-26	68	216	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	4.54e-26	68	216	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.65e-25	69	216	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	4.55e-22	68	216	64	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.961490	0.000560	0.000167	0.000004	0.000002	0.037812

TMHMM  Annotations     

start	end
16	38