CAZyme Information: MGYG000001370_01429

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_01429
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36803.4	9.6404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 15392; End: 16372 Strand: +

Full Sequence      

MKRNSKHIAVTAAIALCAGSTLPFLAGSSTLDPERDSVKSEVPYCVTSPAVPEKISFAGQ
EIDLLRYDHRERMDRELMSFTYMHSTTMLTVKRANRYFPVIEPILKANGLPDDFKYLAVI
ESNLNPLAKSPAGASGLWQFMPATGREFGLEVNSNIDERYHIEKETKAACEYLKKAYAKY
GNWLCVAAAYNAGQGRISTQLQKQMVDQAADLWLVEETSRYMFRLLAAKAVISNPQQYGF
LLKREHLYPPIPYTEVSVNSGIDNLARFAKSKGITYAQLKDANPWLRDITLMNKSGRTYI
LKIPTQAGMHYNPKKTVPYNKKWVIN

Enzyme Prediction     

No EC number prediction in MGYG000001370_01429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	234	1.1e-23	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.33e-62	105	229	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.01e-27	70	301	81	309	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.17e-27	100	205	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	4.21e-18	117	196	5	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.49e-17	97	231	6	148	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT60528.1	2.57e-225	1	326	1	326
QUT66947.1	2.57e-225	1	326	1	326
BBK87615.1	2.57e-225	1	326	1	326
QUT98244.1	2.57e-225	1	326	1	326
QQA29015.1	2.57e-225	1	326	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	9.87e-08	121	230	478	596	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.31e-07	121	230	478	596	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	3.97e-06	128	234	481	594	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	3.98e-06	128	234	482	595	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	3.98e-06	128	234	481	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	6.37e-27	70	301	78	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	6.37e-27	70	301	78	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AGC3	5.49e-07	121	230	505	623	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	5.49e-07	121	230	505	623	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.29e-06	121	230	505	623	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.155954	0.681292	0.153324	0.008107	0.000756	0.000536

TMHMM  Annotations     

start	end
7	29