CAZyme Information: MGYG000001370_01620

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_01620
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	MGYG000001370_28|CGC1	81402.9	6.3191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 17068; End: 19278 Strand: +

Full Sequence      

MRKRPIVLLLSLLISSASVQTSAKDVNKPLYKDAGAPVEKRVDDLLSRMTLEEKVYQLNQ
YTLGFNHNINNLGEAVKNLPAEIGSVIYFDADPQLRNGLQKKAMEESRLGIPVLFGYDVI
HGFRTVYPIPLAQACSWNPALVEQSSAVAALESRMSGVDWTFSPMIDIARDGRWGRVAEG
YGEDPYATAVYTVAAVKGYQGDDLSSDRRVAACLKHYVGYGASEAGRDYVYTEISRQSLW
DTYLPPYEAGVKAGAATLMSGFNDISGIPASANHYTLTEILKNRWKHDGFVVSDWGSVIQ
LVNQGVAADAKEAAEKAFMAGVEMDMTDNCYQRHLAELVKEGKVPVANVDDAVRRVLRVK
FRLGLFEHPYTKEVKQEERLLLPESLRAVERMAEETMVLLKNSDNVLPLSGMKKIALIGP
MAKNRADLLGSWSAHGRAEDVCSIYDAMHREFAGKADILYAEGCDFEDESRGGFAEALDL
AKKADVVVLCLGEKRGWSGENASRSTIALPSVQEALLAALKEAGKPVVVLLANGRPLELV
RIEKLADAIVEMWQPGVAGGKPVAGILSGRVNPSGKLAITFPYMTGQIPVYYNHRSPARE
GRQGRYQDIPSTPLYDFGYGLSYTDYKYGDLKVSADKVKRGETLTVEIPVTNAGSRDGLE
TVHWFICDPVSSISRPVKELKYFEKQLIKAGETKVFRFNVDTERDLSFVDSDGKRFLEPG
DYYLMVKDRKVRISVE

Enzyme Prediction     

No EC number prediction in MGYG000001370_01620.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	104	326	7.5e-67	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	42	726	38	750	beta-glucosidase BglX.
COG1472	BglX	1.74e-94	49	434	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.52e-80	33	736	44	778	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.67e-76	50	359	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	7.79e-64	397	623	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63996.1	0.0	7	735	4	731
QUU00468.1	0.0	12	735	10	734
AZI28033.1	0.0	9	735	5	729
QUT62248.1	0.0	12	735	10	734
BBK85739.1	0.0	12	735	10	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.88e-175	38	726	10	737	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	6.51e-175	39	726	4	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXN_A	1.06e-174	38	726	10	737	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5O_A	3.66e-174	39	726	4	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	3.77e-174	39	726	5	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.91e-166	27	734	26	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.25e-165	27	734	26	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.47e-123	17	726	12	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	8.71e-119	38	729	35	764	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	1.19e-112	8	726	4	740	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000578	0.995206	0.003533	0.000251	0.000216	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001370_01620.