CAZyme Information: MGYG000001370_01807

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_01807
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000001370_32|CGC1	40525.34	6.5662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 7163; End: 8263 Strand: -

Full Sequence      

MKNLILVTALAGFVSLGHAQNASSPYHAMVAQDGSGNYTSIQDAVNAAPENRDEPWCIFV
KNGSYREQVIVPKDKTYIHLIGQDKNKTVIHHNLNVGGQPKEGEDASKTAYWQHSVHNPS
SEVAGFEGAVVKIEGDHFYAENISYINDWGVESQAGPQALAMNTQADCVAFYNCIFRSFQ
DTWMTAKNDSYRLYVKDCWIEGAVDYFYGGGDALLENCTLYNVRSGSVIVAPCHKNAKFG
YVFRNCVVDGNEAAADGKQKLGRPWHNSPVAVYIHTTMRIPVAPEGWTNMGTIPGLFAEY
DSRDADGKVLDLSRRKTEYEGRGNEAGKGSCRAAITKEEADKLTYERIVKGNDGWDPRAW
MKKSVK

Enzyme Prediction     

No EC number prediction in MGYG000001370_01807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	307	5.7e-75	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	4.68e-48	27	352	1	298	Pectinesterase.
PLN02773	PLN02773	8.27e-46	30	291	9	250	pectinesterase
PLN02990	PLN02990	1.90e-41	27	357	260	561	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	3.68e-40	30	291	15	240	putative pectinesterase
PLN02217	PLN02217	7.04e-39	29	287	253	492	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61310.1	4.00e-217	1	363	1	364
QUT93110.1	4.00e-217	1	363	1	364
QDO69224.1	5.68e-217	1	363	1	364
QNL40736.1	8.15e-189	1	363	1	366
QUT27001.1	8.15e-189	1	363	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.68e-26	29	287	10	249	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	2.86e-22	36	311	17	270	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.94e-22	36	311	17	270	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	2.75e-19	27	287	4	245	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.27e-16	23	357	1	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.76e-37	30	291	9	250	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43043	4.72e-37	20	359	51	363	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q8GXA1	2.47e-34	27	287	257	499	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FJ21	4.76e-34	29	287	261	501	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q3E8Z8	1.17e-30	29	287	254	493	Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana OX=3702 GN=PME28 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000294	0.999022	0.000186	0.000180	0.000162	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001370_01807.