CAZyme Information: MGYG000001371_00031

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_00031
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1120		118605.63	4.8597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 4896; End: 8258 Strand: +

Full Sequence      

MRNKLVAWPLVVAMLVSIVFTAGGPPAKASAAGGTNLSIAKNVTASGQSQTYGPSNVNDG
NPNSYWESTNHAFPQWIQVDLGAATSINEIVLKLPASWEPRTQTLSVQGSLNGTTFTNIT
GPSDYAFDPAEGNSVTVSFDETSTRYVRLSVTNNTTWPAAQLSEFEIYGPSVSPPTPPTG
NNIASGKPITASSSTFTYVAAHANDNNVQTYWEGGSNPSTLTLDLESNHDITSIVLKLNP
SPEWSVRTQTIQVLGHDQTTTTFSNLVSAQSYTFTPASGNFVTIPINATVKRLQLSITSN
SGAPAGQIAEIEVYGTAGENPDLIITDMSWTPTSPSENDDITLHATVKNIGSSEAGATTV
NFYLNDAKAGSSPVGPLAAGASATVSLQAGAQAAASYALSAKVDEENNIIELNDGNNSYS
HSSPLVIGSVESSDLVGTIQWTPTTPMAGNAVAFTVNLRNQGNKATASGSHAISVALKNP
AGSTIQNFDGSYHGALAAGASATVQIPGTWTAANGSYTLTTSVAPDANEVPAKRENNVSH
ANLTVYSSRGASMPYTRYDTDDAIRGGGALLKSAPTFDQALTASEASGQRYVALPSSGSN
LEWTVREGEGGAGITMRYTMPDSSDGMGLNGSLDVYVNGSKKKTVPLTSYYSWQYFSSDH
PADAPGGGRPLFRFDEVHWKLETPLQPGDKIRIQKSNADNLEYGVDFIEIEPVPAAISRP
ANSVSVTDFGAIPNDGQDDLTAFEAAVQAAASSGKTLYIPEGTFHLGNMWKIGSVGNLID
DMKIMGAGIWHTNIQFTNPNAASGGISLRIAGQLDFSHIYLNSNLRSRYNQNAVYKGFMD
NFGTNSKIHNVWVEHFECGFWVGDYAHTPAKIAEGLVIENSRIRNNLADGVNFAQGTGHS
TVRNSSIRNNGDDGLAVWTSNVNGAPAGVNNTFSYNTIENNWRAAAIAFFGGSGHKATHN
LIVDTVGGSGIRMNTVFPGYHFQNNTGILFSDTTIIGSGTSKDLYNGERGAIDLEASNDP
IRNVTFTDIDILNTQRSAVQFGYGGGFENIVFNHIRIDGTGLDGVTSSRFSSPHPGAAIY
TYTGNGSATFNNLTMQNIAHPDLYFIQNGFHLILNEAIGD

Enzyme Prediction     

EC	3.2.1.59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	498	1110	1.2e-193	0.9430485762144054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	4.33e-47	550	710	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam07705	CARDB	3.85e-22	321	420	2	100	CARDB. Cell adhesion related domain found in bacteria.
cd00057	FA58C	3.85e-20	30	169	1	143	Substituted updates: Jan 31, 2002
pfam00754	F5_F8_type_C	7.98e-18	42	165	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
smart00231	FA58C	6.89e-09	42	169	13	138	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT12906.1	0.0	1	1120	1	1120
ACX64672.1	0.0	1	1113	1	1113
AYB44992.1	0.0	1	1120	1	1120
AWP28217.1	0.0	1	1114	1	1115
AVV59050.1	0.0	1	1114	1	1115

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	0.0	538	1114	1	577	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	1.12e-48	550	1092	54	557	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	1.81e-33	543	1041	7	494	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	1.84e-32	543	1041	7	494	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	1.84e-32	543	1041	7	494	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999041	0.000224	0.000175	0.000150	0.000131

TMHMM  Annotations     

start	end
5	27