CAZyme Information: MGYG000001371_01057

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_01057
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MGYG000001371_26|CGC1	25832.92	6.4889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 36872; End: 37576 Strand: -

Full Sequence      

MLTLHYSDSWADPGQQNKPYAWRNFSFQQLMDAVYSHTVYVMNTMKNKGVTPDWVQVGNE
TNNGMLWEDGKASVNMKNYAWLVNTGHNAVKSVNSQAKTIVHLSNGYDNELFKWNIGGLI
SNGANFDIIGMSLYPEAGDWSSKVDQTIANAKDMTARYGKSIMISEIGMDYNQPAAAKSF
IQSIKTNVRGLAGGTGLGVFYWEPEATPGYNAGYNKGAWQADGKPTIALEGFKD

Enzyme Prediction     

No EC number prediction in MGYG000001371_01057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	1	216	3e-71	0.6842105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.25e-66	1	218	75	311	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.50e-60	1	208	121	346	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX63136.1	1.23e-170	1	234	117	350
QOT08646.1	3.51e-170	1	234	117	350
AYB46435.1	2.88e-169	1	234	117	350
AVV55045.1	1.84e-165	1	234	117	350
ANA80883.1	1.91e-165	1	234	118	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GPA_A	2.75e-56	1	233	84	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
6GP5_A	7.51e-56	1	233	120	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OSK_A	7.38e-34	1	217	132	367	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJQ_A	9.84e-26	2	204	78	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
4BF7_A	2.36e-22	2	204	95	315	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	9.15e-37	1	208	80	314	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q4WJ80	3.83e-29	2	204	99	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
B0XPR3	2.01e-28	2	204	99	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
A1D3T4	3.94e-27	2	204	99	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
P83691	5.39e-25	2	204	78	298	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000048	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_01057.