CAZyme Information: MGYG000001371_01467

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_01467
• CAZy Family: GH94
• CAZyme Description: 1,2-beta-oligoglucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1125	MGYG000001371_34|CGC1	126676.93	4.8318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 67881; End: 71258 Strand: -

Full Sequence      

MTANHVMNDAKVVLQAGELTFTFLPSGDLYQAAYGTTMINQLLSNPIDGALNNLFLRIHT
EDGIEAVPMLGVHSRSVVTHADNRMMWEGSVKGVAYTIRFTPTDAGAWFWDIELQGEGIQ
ADVVYGQDIGIAHPGAVRNNEAYLSQYIDHAVFRQEDRGYVVCSRQNQPQGGVFPYLQQG
SLTSAVGYATDGFQFFGLSYKETNRAEALFKENLPNKVYQYEFAYTALQSPRVTLNGTAR
FVFYGLFKKDHPDAVTALEYQEELQAAWQQAEARRLTDTGNKLPQLERSDRFGEPLQTVP
LTADELNALYPVRRQEERDGETLLSFFTDTYEHIVLKEKELRVERPHGHILMSGNNVKLG
SPVITTTSYMYGVFNSQLVTGNTNFNKMMSHARNALNVPKTSGQRIYVEMDGQYRLLTMP
SMFEIGFNYVRWYYKTENDKLIITNFTSAAAPEVTLQVCSESGRAYRYLVTMQMTMDVNE
YEVPYHVVQEDGILTFRADSASLSASVYKDLHYRLGVTGAEMQVTDETCLASNVAPGSAS
LTVLELAESAEWAMTVQGSLDAADTPIEARNADEEIANYRSFYASVMNGFHLSLNNGQDD
GLFKVNALAWWYTHNMLVHYSVPHGLEQYGGAAWGTRDVCQGPVEYFMATHKYEQVRDIL
LEVYSHQYEDDGNWPQWFMFDKYAHIQQEESHGDIIVWPLKVLGDYLAVTNDYSILESAV
PYTRKHSFDFTERMYTVLEHVKKQIAYIQEHFLHGTHLSSYGDGDWDDTLQPANAQLKQF
MVSSWTVALTYQTLNQFSRVMESVDQALSGAMGELAEGIQRDFNTYILNSEVIPGFVYME
SKEQSRFLLHPSDEETGIQYRLLPMTRSMISELLTPEQAASHYEIIREQLFCPDGVRLMN
RPAVYAGGVSTHFKRAEQAANFGREVGLQYVHAHIRFVEAMAKLGKSSEVWSGLERINPI
GITEVVPNAELRQSNAYFSSSDGKFNTRYEAQESFDALRSGDIPVKGGWRIYSSGPGIYM
NQLISNALGIREAGGDLVIDPVLPKALDGLEFQFNYAGVPVTFVYHMDGAEQTRVTINGQ
DVSANTVQNRYRTGGVRISGDDFKRLTGNDEQGCVVDIYGGVHEQ

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	78	1088	1.2e-201	0.974903474903475

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	0.0	15	1089	14	1042	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.74e-08	654	960	69	370	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG1554	ATH1	0.008	1029	1091	697	767	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX68151.1	0.0	1	1125	1	1125
QOT09748.1	0.0	1	1125	1	1125
AYB47660.1	0.0	1	1125	1	1125
AWP30661.1	0.0	1	1125	1	1125
ANA79851.1	0.0	1	1125	1	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H3Z_A	0.0	10	1110	9	1105	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H3Z_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H40_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg],5H40_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg]
5H41_A	0.0	10	1103	9	1098	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H41_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H42_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg],5H42_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg]
4ZLE_A	8.08e-11	657	1087	367	769	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
3QDE_A	9.73e-08	573	1085	298	793	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92AT0	4.66e-318	14	1094	7	1060	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1
Q7S0S2	6.93e-07	667	1081	383	767	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_01467.