CAZyme Information: MGYG000001371_03726

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_03726
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000001371_109|CGC1	33737.56	4.5684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 9241; End: 10167 Strand: +

Full Sequence      

MKITVDPSGQGDFVTVQSAVDSIPEQADCLVILEIKKGVYREKITIPSSKPAIRMIGEGA
EETILTYSDNAHTLGEDGQPLGTFRSGSLYVYADDFSAEQLTVRNDSGPGTGQAVAAFID
ADRVSFQHVRLEGDQDTLYVSGGRHYFAECFIEGDVDFIFGPAAAVFDRCMIRCKRSGGY
LTAANTPKEAEFGYVFLDCTISGAPGVENVYLGRPWRDYANVVFIRCEMDGSVHPQGWHN
WNQPDREQTSRYAEYNSRGPGAAPSLRVSWSRDLTEAEAKPFTIEQVLSGQDGWCPPYAP
GSSKLTKG

Enzyme Prediction     

No EC number prediction in MGYG000001371_03726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	289	4.8e-104	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02682	PLN02682	9.77e-92	3	297	71	369	pectinesterase family protein
PLN02773	PLN02773	1.08e-89	3	282	7	290	pectinesterase
PLN02432	PLN02432	6.00e-83	3	292	13	290	putative pectinesterase
pfam01095	Pectinesterase	2.34e-78	3	290	2	297	Pectinesterase.
PLN02671	PLN02671	5.27e-73	3	294	61	356	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT12517.1	2.54e-228	1	308	13	320
ACX65096.1	1.03e-227	1	308	13	320
AIQ51738.1	7.08e-130	1	290	1	290
ANY67900.1	7.08e-130	1	296	1	293
AIQ46129.1	7.08e-130	1	290	1	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.24e-51	5	290	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.14e-51	3	290	9	304	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.48e-41	5	288	35	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.79e-41	13	296	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	6.46e-37	4	267	4	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FM79	9.45e-71	3	294	82	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LVQ0	3.45e-70	3	282	7	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.42e-67	8	292	91	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9SIJ9	3.24e-61	3	297	51	334	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q8LPF3	5.72e-58	3	297	61	359	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_03726.