CAZyme Information: MGYG000001371_03754

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_03754
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774	MGYG000001371_109|CGC3	83582.66	4.9223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 45852; End: 48176 Strand: -

Full Sequence      

MEKYRNAALPVDERVEDLLSRMTLREKVGQLNQHLYGWMAYRRSEGSKTEFELTDLFKEH
VEWGAGMGALYGLFRADPWSGVTYENGIPTQDNAKVANAIQRYVIEHSRLGIPVLLSEEC
PHGHQALDGTLLPVNTAIGSTWNPELIESAYSHVASEIRSRGAHLGLVSVLDILQDPRWG
RSEECYGEDPYLAARMTEAVVFGMQGRNPEEWKSHDKAAAVLKHLCAQGAGQGGRNAGPV
PAGERELREIHLPAAEAGIKAGAAGVMAAYNELDGIPCHANDKLLTGILRDEWGFDGIVM
ADGTAIDRLVSITGDYESAAALALSSGVDLSLWDKSFTTLEQAVKQGKADMESIDRAVAR
VLGLKFRLGLFEQPYVEESLAASTVNNAAARELNVSVAREAVVLLKNDKSVLPLNQGSIK
RLAVIGPNADRLYNQLGDYTSVQREGSGVTALQGIRMVAPEGTDIVFAPGCSVRGMSTQG
LPEAIEAARSADAVVLVLGGSSARQFGGTFDNNGAAIVAEGDPTEMDCGEGVDLAELRLG
GIQEQLVREIHAIGKPVITVLIQGRPLAVGEVAELSDALLCAWYPGSEGGRAIGEILFGQ
VNPSGKLPVSIPRSVGQLPVYYNQKNAGRPRPYVDMPSKPLYPFGFGLSYSSFEYGSPAI
SQNDVTLDHLRSGSRVEVCVEVKNSGKLKGDEVVQLYIQADQSGITRRLRELKGFKKVML
EPGDSTTVTFQLGFEELAIWNRNMDYDVVPCRVSIVVGGHSDWESGVVELKVKA

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	106	332	1.2e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.62e-176	6	758	26	751	beta-glucosidase BglX.
COG1472	BglX	3.53e-84	22	473	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.07e-77	6	730	44	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.05e-67	23	364	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.06e-58	402	650	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX65080.1	0.0	1	774	1	774
AYB44633.1	0.0	1	774	1	774
QOT12541.1	0.0	1	774	1	774
AZS15933.1	0.0	1	761	1	759
QUL56516.1	0.0	1	759	1	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.92e-143	2	761	34	774	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	5.08e-127	11	761	10	741	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.78e-126	11	761	10	741	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.32e-124	3	762	6	746	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.01e-123	3	762	6	746	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	4.03e-138	70	761	6	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.73e-128	12	758	35	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.87e-124	12	761	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	4.71e-122	4	771	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	1.31e-80	12	758	77	812	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_03754.