CAZyme Information: MGYG000001371_04973

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_04973
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		59513.07	8.7728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 12144; End: 13748 Strand: -

Full Sequence      

MKKYILSLCFLLSFTAFISPLQASATQAPSPTAFHDISSSFAKDAIYRLAKRGIVSGDGT
GAFLPRNPVTRAEFIAMVARMLNMEPVPNDLPAFQDVSRSAWYYGWVHAGLNLSIVEGNG
YKFFPNASITRQEAAVIVIRAMKDSGYDNGYTAGYYTDSESIAAWAWRAVGQATNTGWLQ
GSQGQFRPLDPITREETAMLLDRVLQSGNVKSMIDSQPAANIHMGWLYNGSTKQYISYAK
RAGLNVLVPRWYYMESNGKLSDSTDIELLNWARNNGRQVWAMVGNRANAEGTHQVLSSPQ
SRKSVVDSIAASVSRYRLDGINIDFENVMPEDRQNLTAFITQLSTEMKRLGAKLSIDVSP
DLNTDWTAAFDYQALGSQVDYMVLMSYDQHWGGSPKAGSVSSLPWSESALSKLLTQVPAK
KSIIAYPLYTRDWQIASSVSSSDIGLIEQGHRIRLTQASLTWNASVAQYEAAYSSRGIQH
RIWTEDSRSLSWKHLMAAKYRIAGYAYWYPGAETTDVWQAIDNAERYASYSFRI

Enzyme Prediction     

No EC number prediction in MGYG000001371_04973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	254	509	2.1e-39	0.7702702702702703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	8.62e-72	224	521	5	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.37e-42	225	521	113	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	7.12e-29	238	518	18	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	7.36e-23	272	508	62	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	8.51e-23	272	508	59	302	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT11554.1	0.0	1	534	1	534
AYB43652.1	0.0	1	534	1	534
ACX66234.1	0.0	64	534	1	471
AWP27073.1	0.0	1	534	1	534
AVV57916.1	0.0	1	534	1	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	4.23e-27	252	508	41	306	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	5.18e-20	292	523	88	337	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3J_A	8.56e-20	288	521	182	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
5JH8_A	1.48e-19	288	521	77	310	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	5.16e-16	244	523	135	425	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	2.00e-32	219	521	27	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	1.28e-26	252	508	133	398	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P38535	3.01e-20	34	209	908	1085	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38536	3.63e-20	34	210	1682	1861	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P0DPJ9	5.90e-20	288	521	181	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.998962	0.000231	0.000183	0.000183	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_04973.