CAZyme Information: MGYG000001371_05478

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_05478
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774	MGYG000001371_162|CGC1	86258.11	4.8299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 674; End: 2998 Strand: -

Full Sequence      

MKFTDGNWLIREGYSVSGAVQAYDFAVKGDTLTAYASTAPIPGRGATINAQLITVQFHSP
APGVIGVKLVHYAGVRDRGPAFELYKQEGDHTVIEENDQQAVLRSGNLSVVIKKGPEWSV
HFYRGEERITGSRAKSMAHIVEDGGQTYMREELDLGVGEWVYGLGERFTSFVKNGQVVDI
WNQDGGTSSEQAYKNIPFYVTNKGYGVFVNQPDLVSFEVASEKVKKVQFSVPGESLEYFV
IDGPDPKGVLDKYTSLTGKPALPPAWTFGLWLSTSFTTQYDEATVNSFVDGMLERDIPLQ
VFHFDCFWMKGLNWTDFQWDEEVFPDPEGMLKRLKEKGLKICVWINPYIAQRSRLFEEGR
EKGYLVKKANGDVWQWNLWQPGMALVDFTNPDACEWYAGYLRELADMGVDSFKTDFGERI
PTDVVYFDGSDPHKMHNYYTQLYNKVVFDVLVEKFGKNQAAVFARSATVGGQQFPVHWGG
DCYADYESMAESLRGGLSLGLGGFGFWSHDIGGFENTAPAHVFKRWLAFGLLSSHSRLHG
SSSYRVPWSYDEEAVDVTRFFTKLKSRLMPYLFHTAVQASEQGVPSMRAMFLEFPEDPAV
EMLDRQYMLGDSLLVAPVFSEKGDVKYYLPKGRWTHLLTGETVDGGTWRKETYGFLGLPL
FVRGNSFLALGASDALPEYDYADGVELGLYALEDGSEASAIVRNMNGESELVVRAVRAGS
RINFTVEGSGKPFSVKLYDTGNVSSVEGSGVSLQEGKIQVDAGQQAMAFSVELG

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	238	667	5.4e-133	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	8	772	1	766	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10658	PRK10658	0.0	1	665	1	665	putative alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	3.65e-175	258	568	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	4.75e-160	239	666	1	440	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	7.11e-72	89	666	25	621	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT10060.1	0.0	1	774	1	774
ACX67823.1	0.0	1	773	1	773
AYB42114.1	0.0	1	773	1	773
AWP25680.1	0.0	1	773	1	774
AVV56514.1	0.0	1	773	1	774

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XSI_A	0.0	1	758	1	760	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
2F2H_A	0.0	1	758	1	760	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1WE5_A	0.0	2	758	2	760	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	9.95e-112	163	670	206	717	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	4.51e-74	88	668	90	688	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	0.0	1	758	1	760	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	3.12e-258	1	687	1	715	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	1.79e-255	1	760	1	760	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	1.43e-72	94	671	86	677	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	3.94e-59	149	695	102	649	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_05478.